(data stored in ACNUC7421 zone)

EMBL: CP000031.PE130

CP000031.PE130       Location/Qualifiers
FT   CDS             complement(138223..140442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0132"
FT                   /product="sensor histidine kinase/response regulator"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00512; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0132"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93460"
FT                   /db_xref="GOA:Q5LWT5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWT5"
FT                   /protein_id="AAV93460.1"
FT                   /translation="MSLVNKLAEERRARLAAERLLELKQAELSAANRKLGRHALALTKQ
FT                   IGEKQAEVATVRDENEKVKSDLTVANAKIEVAERRLWHSIQTIQDGFAFFDSDSKLIGA
FT                   NTAYLNVFDGLDEVAPGISYMRILQLMTEEGIIDTGELAAEEWRQMMHERWISPTPEPV
FT                   VIRMWNDQYVKMIDQRGHGGDVVSLALNITSTVRYEAELRAAREKAEAANRAKSAFLAN
FT                   MSHEIRTPMNGVVGMAELLCDTALDEEQQLYASTIKNSGEALLVIINDVLDYSKIEAEK
FT                   MMLHPEPFDLERCIHEVAMLMQPIVRDKGLTLLVDYDLFLPTLFVGDPGRVRQVLTNLL
FT                   GNAVKFTTKGHILIRVTGVPDPATGRCAIHVAIEDTGIGIPREKLAHIFGEFNQVENER
FT                   NRQFDGTGLGLAISQRLIQMMGGTVWVESEEGRGSCFGFRVTLPMSEEAQPVLPNLPGR
FT                   LQHVLIVDDLAVNRAILEKQLAQLGVRVTCCASGAQALEKMSDCVDLVLSDHNMPEMDG
FT                   LELAEALRGAGWSDLPIFLLSSNPGMAHADPAKRHVQGILQKPIPRAELFARLSDMRTE
FT                   ITSVQDPAAVSAPVTKPAQDAPGEPTERRQMRVLAAEDNRTNQLVFRKMVKTLDIDLRF
FT                   ANNGLEAVEIWQDFQPDLIFMDISMPKMDGKQATGEIRRLEAGTGRHVPIVALTAHAMA
FT                   GDAEGILAAGLDQYLTKPLRKALIHQHIAEACPAGALPVEPESGE"
     MSLVNKLAEE RRARLAAERL LELKQAELSA ANRKLGRHAL ALTKQIGEKQ AEVATVRDEN        60
     EKVKSDLTVA NAKIEVAERR LWHSIQTIQD GFAFFDSDSK LIGANTAYLN VFDGLDEVAP       120
     GISYMRILQL MTEEGIIDTG ELAAEEWRQM MHERWISPTP EPVVIRMWND QYVKMIDQRG       180
     HGGDVVSLAL NITSTVRYEA ELRAAREKAE AANRAKSAFL ANMSHEIRTP MNGVVGMAEL       240
     LCDTALDEEQ QLYASTIKNS GEALLVIIND VLDYSKIEAE KMMLHPEPFD LERCIHEVAM       300
     LMQPIVRDKG LTLLVDYDLF LPTLFVGDPG RVRQVLTNLL GNAVKFTTKG HILIRVTGVP       360
     DPATGRCAIH VAIEDTGIGI PREKLAHIFG EFNQVENERN RQFDGTGLGL AISQRLIQMM       420
     GGTVWVESEE GRGSCFGFRV TLPMSEEAQP VLPNLPGRLQ HVLIVDDLAV NRAILEKQLA       480
     QLGVRVTCCA SGAQALEKMS DCVDLVLSDH NMPEMDGLEL AEALRGAGWS DLPIFLLSSN       540
     PGMAHADPAK RHVQGILQKP IPRAELFARL SDMRTEITSV QDPAAVSAPV TKPAQDAPGE       600
     PTERRQMRVL AAEDNRTNQL VFRKMVKTLD IDLRFANNGL EAVEIWQDFQ PDLIFMDISM       660
     PKMDGKQATG EIRRLEAGTG RHVPIVALTA HAMAGDAEGI LAAGLDQYLT KPLRKALIHQ       720
     HIAEACPAGA LPVEPESGE                                                    739
//

If you have problems or comments...

PBIL Back to PBIL home page