(data stored in ACNUC9435 zone)

EMBL: CP000031.PE131

CP000031.PE131       Location/Qualifiers
FT   CDS             140575..146001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0133"
FT                   /product="PAN domain protein"
FT                   /note="identified by match to protein family HMM PF00024;
FT                   match to protein family HMM PF01835; match to protein
FT                   family HMM PF07703"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93461"
FT                   /db_xref="GOA:Q5LWT4"
FT                   /db_xref="InterPro:IPR000177"
FT                   /db_xref="InterPro:IPR001599"
FT                   /db_xref="InterPro:IPR002890"
FT                   /db_xref="InterPro:IPR003609"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR011625"
FT                   /db_xref="InterPro:IPR021868"
FT                   /db_xref="InterPro:IPR026284"
FT                   /db_xref="InterPro:IPR041203"
FT                   /db_xref="InterPro:IPR041246"
FT                   /db_xref="InterPro:IPR041462"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWT4"
FT                   /protein_id="AAV93461.1"
FT                   /translation="MRRFGFLAILSLQLAFFGVSGLSAQEAAPGFRYLATRDMDFYGED
FT                   LDALFDTDLQSCIRACSANNACNAFTFNARSNACFPKRGVSEQTPYQGALSAVKLPSPA
FT                   AVRDRARQQAARLAFLPDRDLTRAVAQARDLGLRYAAGGMELDQVIAAMRNAGEGAQAA
FT                   GWAGLAVSLSDRADLWAEYARLLLSVRSDDSSIKRDHARRAVSAAINAYLRADRPGAEV
FT                   SALALLAQALERDGRGRDMVPVLRLASDIQPREDVLAALDRAIGKYGFRVVETTVESDS
FT                   AQPRICAQFSDPLARSGVDYEPFVHSPEGDLVVQADGNQLCLDGVEHGKRYRITLRAGL
FT                   PAGSGEALWKDVTLTHYVRDRSPAVRFPGRSYVLPKSADAAIPVETVNATTLDLILRRV
FT                   SDRNLLRAVQEGYFARPLSYWEDEHFASDIAQEVWTGSAEVASTLNRDMTTRLPLAEAI
FT                   SGQAAGIYTLTARVPGADPYDNPGATQWFVLSDLGLSSISGNDGLHVSVRGLSDAAPRA
FT                   AVDLTLISRANAVLGRVQTDAQGLARFEPGLTRGTGAAAPALILATAGDTDLGFLSLID
FT                   PAFDLSDRGVEGRKPAGPVDVFLTTDRGAYRAGETIHATALSRDGTARAIDGLPLTAIL
FT                   TRPDGVEYGRKVSDGGVAGGHVFALTTGASAPRGTWRLDIKADPDGPALASQTLLVEDF
FT                   LPERIDFDLALPDAPILPGDSPPLSIEARYLFGAPGADLSIEGQVQLRAADQIAGWPGY
FT                   RFGRHDAGLQTRTSHFGDARTDAAGNARLAVEIPQIDAEGKPLEAVVTARLADGAARPV
FT                   ERRISVPVSPATPVIGIKPLFEDVVSEGTEAGFQVIGLTPDLTPQPMRIKWTLNRVETR
FT                   YQWYQLYGNWNWEPVTRRTRIATGEADLGSDPLSLSQPVEWGEYELLVERLDGAYVASS
FT                   ADFYAGWYQAADAAATPDRLELSLDKDSYRPGDTARLRIVPRMAGTALVTVLSDRVIAR
FT                   QAVEVAAGESVIPLTVTEDWGTGAYVTATVIRPMDVAAGQNPARALGLAHATIEPVGKA
FT                   LTVAIDAPEVAKPRATQPVRLTVAGAQAGDEVWLTLAAVDLGILNLTGFQSPDPQGHYF
FT                   GQRRLGVEMRDVYGRLIDGMNGAMGIVRSGGDADNGLRMQSPPPTQDLMAVFSGPVQVG
FT                   ADGGVSVDVPLPAFNGTVRLMAVAWSDQAVGQAERDMIVRDPVVVTATVPRFLAPGDSS
FT                   RLRLEVVHADGPPGEMALKLASAPGLQLGAAPDRFTLTEGGKAVFEVPVTATALGDPVL
FT                   TVELETPGGQELRQVLRLPVRANDPVVAQTRRFALGAGDSFLFSRDVFTGLRPGSARAI
FT                   LSAGPLARFDAPGLLGVLDRYPYGCTEQVTSQAMPLLYLGAVAQAAGLGTGPQVAERID
FT                   AAIRRILTRQSANGAFGLWRAESGDFWLDAYASDFLSRARAEGYALPDRAFAMAMDNLR
FT                   NRLNYAPDFDEGGEDIAYALMVLAREGAAAMGDLRYYADVKADAFTTPLGAAQLGSALA
FT                   MYGDQTRADAMFARAARMVAGQRPEAPVWRADYGTSLRDAAGLLTLAAEAGSAVIDRDS
FT                   LISRISQPAGEMSTQEAAWSLLAAQALVKQPEQSGLRVNGAAVDGPFVQVLAGTSDEVL
FT                   NITAVDGGATDITLTMLGVPEVPLPAGGTGYTITRARYTMDGAPIQRDAFAIGERFVTV
FT                   LTVTPFEASGGRLMVNDPLPAGFEIDNPSLLRSGDVRALDWLSLDEASHTEFRSDRFLA
FT                   AVDLYGTRPVTLAYVTRAVSPGAFHHPAASVEDMYRPRYRARTDTGRIRVGQ"
     MRRFGFLAIL SLQLAFFGVS GLSAQEAAPG FRYLATRDMD FYGEDLDALF DTDLQSCIRA        60
     CSANNACNAF TFNARSNACF PKRGVSEQTP YQGALSAVKL PSPAAVRDRA RQQAARLAFL       120
     PDRDLTRAVA QARDLGLRYA AGGMELDQVI AAMRNAGEGA QAAGWAGLAV SLSDRADLWA       180
     EYARLLLSVR SDDSSIKRDH ARRAVSAAIN AYLRADRPGA EVSALALLAQ ALERDGRGRD       240
     MVPVLRLASD IQPREDVLAA LDRAIGKYGF RVVETTVESD SAQPRICAQF SDPLARSGVD       300
     YEPFVHSPEG DLVVQADGNQ LCLDGVEHGK RYRITLRAGL PAGSGEALWK DVTLTHYVRD       360
     RSPAVRFPGR SYVLPKSADA AIPVETVNAT TLDLILRRVS DRNLLRAVQE GYFARPLSYW       420
     EDEHFASDIA QEVWTGSAEV ASTLNRDMTT RLPLAEAISG QAAGIYTLTA RVPGADPYDN       480
     PGATQWFVLS DLGLSSISGN DGLHVSVRGL SDAAPRAAVD LTLISRANAV LGRVQTDAQG       540
     LARFEPGLTR GTGAAAPALI LATAGDTDLG FLSLIDPAFD LSDRGVEGRK PAGPVDVFLT       600
     TDRGAYRAGE TIHATALSRD GTARAIDGLP LTAILTRPDG VEYGRKVSDG GVAGGHVFAL       660
     TTGASAPRGT WRLDIKADPD GPALASQTLL VEDFLPERID FDLALPDAPI LPGDSPPLSI       720
     EARYLFGAPG ADLSIEGQVQ LRAADQIAGW PGYRFGRHDA GLQTRTSHFG DARTDAAGNA       780
     RLAVEIPQID AEGKPLEAVV TARLADGAAR PVERRISVPV SPATPVIGIK PLFEDVVSEG       840
     TEAGFQVIGL TPDLTPQPMR IKWTLNRVET RYQWYQLYGN WNWEPVTRRT RIATGEADLG       900
     SDPLSLSQPV EWGEYELLVE RLDGAYVASS ADFYAGWYQA ADAAATPDRL ELSLDKDSYR       960
     PGDTARLRIV PRMAGTALVT VLSDRVIARQ AVEVAAGESV IPLTVTEDWG TGAYVTATVI      1020
     RPMDVAAGQN PARALGLAHA TIEPVGKALT VAIDAPEVAK PRATQPVRLT VAGAQAGDEV      1080
     WLTLAAVDLG ILNLTGFQSP DPQGHYFGQR RLGVEMRDVY GRLIDGMNGA MGIVRSGGDA      1140
     DNGLRMQSPP PTQDLMAVFS GPVQVGADGG VSVDVPLPAF NGTVRLMAVA WSDQAVGQAE      1200
     RDMIVRDPVV VTATVPRFLA PGDSSRLRLE VVHADGPPGE MALKLASAPG LQLGAAPDRF      1260
     TLTEGGKAVF EVPVTATALG DPVLTVELET PGGQELRQVL RLPVRANDPV VAQTRRFALG      1320
     AGDSFLFSRD VFTGLRPGSA RAILSAGPLA RFDAPGLLGV LDRYPYGCTE QVTSQAMPLL      1380
     YLGAVAQAAG LGTGPQVAER IDAAIRRILT RQSANGAFGL WRAESGDFWL DAYASDFLSR      1440
     ARAEGYALPD RAFAMAMDNL RNRLNYAPDF DEGGEDIAYA LMVLAREGAA AMGDLRYYAD      1500
     VKADAFTTPL GAAQLGSALA MYGDQTRADA MFARAARMVA GQRPEAPVWR ADYGTSLRDA      1560
     AGLLTLAAEA GSAVIDRDSL ISRISQPAGE MSTQEAAWSL LAAQALVKQP EQSGLRVNGA      1620
     AVDGPFVQVL AGTSDEVLNI TAVDGGATDI TLTMLGVPEV PLPAGGTGYT ITRARYTMDG      1680
     APIQRDAFAI GERFVTVLTV TPFEASGGRL MVNDPLPAGF EIDNPSLLRS GDVRALDWLS      1740
     LDEASHTEFR SDRFLAAVDL YGTRPVTLAY VTRAVSPGAF HHPAASVEDM YRPRYRARTD      1800
     TGRIRVGQ                                                               1808
//

If you have problems or comments...

PBIL Back to PBIL home page