(data stored in ACNUC9435 zone)

EMBL: CP000031.PE134

CP000031.PE134       Location/Qualifiers
FT   CDS             complement(148600..150645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0136"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAC47727.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93464"
FT                   /db_xref="GOA:Q5LWT1"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWT1"
FT                   /protein_id="AAV93464.1"
FT                   /translation="MTGDLLLDPLVPLPLLIALAALSLAGIALALWRGLSGWALRGLAA
FT                   LVLLAALAGPVWQVEDRAPLSDIVLMVEDQSASQGLSDRPDQTTSAADQLAASIESRPN
FT                   TELRRIIVGDGEGDTGTQLMAALNEALNEEPRARIAGILALSDGQVHDLDRAPALPAPM
FT                   HLLLSGRATDWDRRLIVRNAPAFAIIGEPVTLSLRIEDSGAVPAGQGALAELQISVDGG
FT                   PPERLTLPVGQDLELPVTLPHGGRNVVQFSVPVAEGELTDRNNTALIQMNGVRDRLRVL
FT                   LVSGQPHPGGRTWRNLLKSDSSVDLVHFTILRPPEKQDGVPVDELSLIAFPTRELFLEK
FT                   IDDFDLIIFDRYKRRGILPAIYLDNVANYVNRGGAVLVAAGPDFATADSIYRTPLSPVL
FT                   PARPTARVIEEAYRAQVTEEGARHPVTAQLDSAGEWGRWLRQIEVTQDSGHVLMSGVEG
FT                   RPLLVLDRVGEGRVALLATDHAWLWGRGYEGGGPQLELLRRLAHWMMKEPELEEDALWA
FT                   EAQGQTMRIIRRTLDTSVGSVTITRPDGGEDVLPMEEVSPGRFEALYQGPEIGLYRLRE
FT                   GDQSAVIGLGPAAPREFEATIATAALMEPLITPLKSGIFRLEDGLPTIRNVREGRPAAG
FT                   RGWLGLTPRGAYETRDVRQTPLAPAWLVLLLASGFVIAGWLREGRR"
     MTGDLLLDPL VPLPLLIALA ALSLAGIALA LWRGLSGWAL RGLAALVLLA ALAGPVWQVE        60
     DRAPLSDIVL MVEDQSASQG LSDRPDQTTS AADQLAASIE SRPNTELRRI IVGDGEGDTG       120
     TQLMAALNEA LNEEPRARIA GILALSDGQV HDLDRAPALP APMHLLLSGR ATDWDRRLIV       180
     RNAPAFAIIG EPVTLSLRIE DSGAVPAGQG ALAELQISVD GGPPERLTLP VGQDLELPVT       240
     LPHGGRNVVQ FSVPVAEGEL TDRNNTALIQ MNGVRDRLRV LLVSGQPHPG GRTWRNLLKS       300
     DSSVDLVHFT ILRPPEKQDG VPVDELSLIA FPTRELFLEK IDDFDLIIFD RYKRRGILPA       360
     IYLDNVANYV NRGGAVLVAA GPDFATADSI YRTPLSPVLP ARPTARVIEE AYRAQVTEEG       420
     ARHPVTAQLD SAGEWGRWLR QIEVTQDSGH VLMSGVEGRP LLVLDRVGEG RVALLATDHA       480
     WLWGRGYEGG GPQLELLRRL AHWMMKEPEL EEDALWAEAQ GQTMRIIRRT LDTSVGSVTI       540
     TRPDGGEDVL PMEEVSPGRF EALYQGPEIG LYRLREGDQS AVIGLGPAAP REFEATIATA       600
     ALMEPLITPL KSGIFRLEDG LPTIRNVREG RPAAGRGWLG LTPRGAYETR DVRQTPLAPA       660
     WLVLLLASGF VIAGWLREGR R                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page