(data stored in ACNUC7421 zone)

EMBL: CP000031.PE136

CP000031.PE136       Location/Qualifiers
FT   CDS             complement(153401..154276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0138"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAN30463.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93466"
FT                   /db_xref="GOA:Q5LWS9"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWS9"
FT                   /protein_id="AAV93466.1"
FT                   /translation="MSAAPALRHRAETAAAPLPPLLARAEYLAGTVLLGDHGRRRAGLG
FT                   DDFWQYRPAQPGDSRRMIDHRRSARGDLQYVREREWQIAQSVMLWVDQGASMRFSSDKR
FT                   LEAKADRARLLALAVAILLVRGGERVGLTGTTLPPRRGNAQVHRLAEAWSRDAEADYAP
FT                   PEHRAMIPHARALFVSDFLGDLKEVELALSKAADRGVRGVLMQVLDPAEESFPYRGRTL
FT                   FESVGGTLRHETLKAGELRERYLVRLAERRDALMALTRATGWQLGLHHTGDSAQSALLW
FT                   LWRALDGRVR"
     MSAAPALRHR AETAAAPLPP LLARAEYLAG TVLLGDHGRR RAGLGDDFWQ YRPAQPGDSR        60
     RMIDHRRSAR GDLQYVRERE WQIAQSVMLW VDQGASMRFS SDKRLEAKAD RARLLALAVA       120
     ILLVRGGERV GLTGTTLPPR RGNAQVHRLA EAWSRDAEAD YAPPEHRAMI PHARALFVSD       180
     FLGDLKEVEL ALSKAADRGV RGVLMQVLDP AEESFPYRGR TLFESVGGTL RHETLKAGEL       240
     RERYLVRLAE RRDALMALTR ATGWQLGLHH TGDSAQSALL WLWRALDGRV R                291
//

If you have problems or comments...

PBIL Back to PBIL home page