(data stored in ACNUC7421 zone)

EMBL: CP000031.PE139

CP000031.PE139       Location/Qualifiers
FT   CDS             complement(155946..156515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0141"
FT                   /product="DNA binding protein, putative"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93469"
FT                   /db_xref="GOA:Q5LWU4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWU4"
FT                   /protein_id="AAV93469.1"
FT                   /translation="MTENSDDILNRLPARLKEARRAQGLSLEAVANLSGVSRSMVSQIE
FT                   RGESSPTIATLWNLTRALQVDFAGLLEAAEAADRIDTLRASEVPSIDNMGQGCRIRILS
FT                   PPEDAGGHEVYDISFKPGGTLNSQPHARGTREQLTVLDGAVRVTSGAAAQDLGPGDTAR
FT                   YAADIPHKISASGDGPARVFLIVKTA"
     MTENSDDILN RLPARLKEAR RAQGLSLEAV ANLSGVSRSM VSQIERGESS PTIATLWNLT        60
     RALQVDFAGL LEAAEAADRI DTLRASEVPS IDNMGQGCRI RILSPPEDAG GHEVYDISFK       120
     PGGTLNSQPH ARGTREQLTV LDGAVRVTSG AAAQDLGPGD TARYAADIPH KISASGDGPA       180
     RVFLIVKTA                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page