(data stored in ACNUC7421 zone)

EMBL: CP000031.PE145

CP000031.PE145       Location/Qualifiers
FT   CDS             162522..163298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0147"
FT                   /product="enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="identified by similarity to SP:P14604; match to
FT                   protein family HMM PF00378"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93475"
FT                   /db_xref="GOA:Q5LWT8"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWT8"
FT                   /protein_id="AAV93475.1"
FT                   /translation="MAFETIIVEVEDHVALIRLNRPDALNALNTQLLGELCTALEEADG
FT                   NDKVRCIVITGSDKAFAAGADIREMSQKTYVEVYSENLFAAANDRVSAIRKPIIAAVAG
FT                   YALGGGCELAMLCDFIIAADTAKFGQPEINLGVIAGIGGTQRLTRLVGKSKSMDLNLTG
FT                   RFMDAEEAERAGLVSRVVPAKKLVEEALSAAQKIAEKSMISAYAVKEAVNRSYETTLSE
FT                   GLLFERRVFHSMFATEDQKEGMAAFLEKRAAQFRDK"
     MAFETIIVEV EDHVALIRLN RPDALNALNT QLLGELCTAL EEADGNDKVR CIVITGSDKA        60
     FAAGADIREM SQKTYVEVYS ENLFAAANDR VSAIRKPIIA AVAGYALGGG CELAMLCDFI       120
     IAADTAKFGQ PEINLGVIAG IGGTQRLTRL VGKSKSMDLN LTGRFMDAEE AERAGLVSRV       180
     VPAKKLVEEA LSAAQKIAEK SMISAYAVKE AVNRSYETTL SEGLLFERRV FHSMFATEDQ       240
     KEGMAAFLEK RAAQFRDK                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page