(data stored in ACNUC7421 zone)

EMBL: CP000031.PE150

CP000031.PE150       Location/Qualifiers
FT   CDS             168274..168894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0152"
FT                   /product="transporter, LysE family"
FT                   /note="identified by match to protein family HMM PF01810"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93480"
FT                   /db_xref="GOA:Q5LWV1"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWV1"
FT                   /protein_id="AAV93480.1"
FT                   /translation="MTLSAVDLALYAGAVFVLFLTPGPVWLALTARTLSGGFQAAWPLT
FT                   LGVVVGDSLWPVLAVLGIGWITAASTQIALALKVVAVLVFVTLGIVTIRNADRTIASDS
FT                   RLTRPGIWAGFLAGLVVILGNPKAVLFYMGILPGFFDLSDITTIDLVAIVAVSQVVPLV
FT                   GNLMLAAFVDRVRRVLSSPRALRRMNLTAGGMLIVVGLILPFT"
     MTLSAVDLAL YAGAVFVLFL TPGPVWLALT ARTLSGGFQA AWPLTLGVVV GDSLWPVLAV        60
     LGIGWITAAS TQIALALKVV AVLVFVTLGI VTIRNADRTI ASDSRLTRPG IWAGFLAGLV       120
     VILGNPKAVL FYMGILPGFF DLSDITTIDL VAIVAVSQVV PLVGNLMLAA FVDRVRRVLS       180
     SPRALRRMNL TAGGMLIVVG LILPFT                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page