(data stored in ACNUC7421 zone)

EMBL: CP000031.PE151

CP000031.PE151       Location/Qualifiers
FT   CDS             complement(168887..169474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0153"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0153"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93481"
FT                   /db_xref="GOA:Q5LWV0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWV0"
FT                   /protein_id="AAV93481.1"
FT                   /translation="MTRPPQKRRLETRARLLAEAARLVEAQGYAGLRVEDVVEAAGVAK
FT                   GTLFSHFTDKDGLLAVLIGAEVMRLIDGMETAGPPDDLPQLMHRLAPLLDFIASDRVIF
FT                   DLLLRYSGSTGAERNEVVADGFYRQIDLWAGWIAGMQAAGTVRGDHPPALLAEGIQAFL
FT                   NQIIAIRFCQGGQATGTPAGALYPFLAAWLIT"
     MTRPPQKRRL ETRARLLAEA ARLVEAQGYA GLRVEDVVEA AGVAKGTLFS HFTDKDGLLA        60
     VLIGAEVMRL IDGMETAGPP DDLPQLMHRL APLLDFIASD RVIFDLLLRY SGSTGAERNE       120
     VVADGFYRQI DLWAGWIAGM QAAGTVRGDH PPALLAEGIQ AFLNQIIAIR FCQGGQATGT       180
     PAGALYPFLA AWLIT                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page