(data stored in ACNUC7421 zone)

EMBL: CP000031.PE152

CP000031.PE152       Location/Qualifiers
FT   CDS             169581..170174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0154"
FT                   /product="NAD(P)H dehydrogenase, quinone family"
FT                   /note="identified by similarity to SP:P45245; match to
FT                   protein family HMM PF02525"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93482"
FT                   /db_xref="GOA:Q5LWU9"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWU9"
FT                   /protein_id="AAV93482.1"
FT                   /translation="MSTRKIIVLNGHPGQMSLSKSLSEAYAGAARESGHQVRYHDLSQM
FT                   RFDMDYGEGGYKNTKPLEPELEAFLADLEWAEHVVLATPLWWGAIPAKLKGLFDRALLP
FT                   GRAFDSRNTNFLGLPAPLLKGRTARVLMTSDTPAMLLGLFYSNAIKKVLARQILGFVGI
FT                   KPARFSTFAPATGAEGDRVRKWLRKAAQMGAKAA"
     MSTRKIIVLN GHPGQMSLSK SLSEAYAGAA RESGHQVRYH DLSQMRFDMD YGEGGYKNTK        60
     PLEPELEAFL ADLEWAEHVV LATPLWWGAI PAKLKGLFDR ALLPGRAFDS RNTNFLGLPA       120
     PLLKGRTARV LMTSDTPAML LGLFYSNAIK KVLARQILGF VGIKPARFST FAPATGAEGD       180
     RVRKWLRKAA QMGAKAA                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page