(data stored in ACNUC7421 zone)

EMBL: CP000031.PE155

CP000031.PE155       Location/Qualifiers
FT   CDS             174344..176026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0157"
FT                   /product="TROVE domain protein"
FT                   /note="identified by match to protein family HMM PF05731"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93485"
FT                   /db_xref="GOA:Q5LWW2"
FT                   /db_xref="InterPro:IPR008858"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR037214"
FT                   /db_xref="InterPro:IPR040322"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWW2"
FT                   /protein_id="AAV93485.1"
FT                   /translation="MPNSAISVIYAQKQHTRLISCFSRRFPNPMSQSPRTKEDEREMAN
FT                   KSVFASIKGRLLPKATTRNAEGAPAYAYSDAHALAQVAVTGTFGGMFYTDPRDELEYVV
FT                   DLAEAVEPCFLAQAAIYARQSGYMKDMPAVLLAVLARRDPALFRRVFGRVVDNGKMLRT
FT                   FVQVMRSGQTGRKSLGSAPKAMVQNWLNTASDRALLAANIGNDPSLADVIRMVHPKPET
FT                   KEREALFAWIVGRPCNLALLPQALQDWLAFKAGAKGPVPDVPFQMLTQLDLTPQHWARI
FT                   ARKGSWQMVRQNLNTFQRHGVFNVAKNVAHVAALLRDPEAIGKARAFPYQLMVAAQNLS
FT                   ADMPREIVEALHDAMEIAVRNVPKIDGQVVVCPDVSGSMTCAVTGYRPGATSVVRHVDV
FT                   AALVAAAFSRVNRGCQVLPFDFEVRDVRLEPRDTILTNAERLAALGGGGTTCSAPLKWL
FT                   NDRGRSPDLVVFVSDNQSWVDARAGGQGTAMLAEWEKVKRRNPKARLVCIDIAPYGTSQ
FT                   VQTREDVLNIGGFSDAVFDQIAGFAAGRTGPDHWVGEIEKIEL"
     MPNSAISVIY AQKQHTRLIS CFSRRFPNPM SQSPRTKEDE REMANKSVFA SIKGRLLPKA        60
     TTRNAEGAPA YAYSDAHALA QVAVTGTFGG MFYTDPRDEL EYVVDLAEAV EPCFLAQAAI       120
     YARQSGYMKD MPAVLLAVLA RRDPALFRRV FGRVVDNGKM LRTFVQVMRS GQTGRKSLGS       180
     APKAMVQNWL NTASDRALLA ANIGNDPSLA DVIRMVHPKP ETKEREALFA WIVGRPCNLA       240
     LLPQALQDWL AFKAGAKGPV PDVPFQMLTQ LDLTPQHWAR IARKGSWQMV RQNLNTFQRH       300
     GVFNVAKNVA HVAALLRDPE AIGKARAFPY QLMVAAQNLS ADMPREIVEA LHDAMEIAVR       360
     NVPKIDGQVV VCPDVSGSMT CAVTGYRPGA TSVVRHVDVA ALVAAAFSRV NRGCQVLPFD       420
     FEVRDVRLEP RDTILTNAER LAALGGGGTT CSAPLKWLND RGRSPDLVVF VSDNQSWVDA       480
     RAGGQGTAML AEWEKVKRRN PKARLVCIDI APYGTSQVQT REDVLNIGGF SDAVFDQIAG       540
     FAAGRTGPDH WVGEIEKIEL                                                   560
//

If you have problems or comments...

PBIL Back to PBIL home page