(data stored in ACNUC9435 zone)

EMBL: CP000031.PE156

CP000031.PE156       Location/Qualifiers
FT   CDS             177007..178419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0160"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:D75521"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93486"
FT                   /db_xref="GOA:Q5LWW1"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWW1"
FT                   /protein_id="AAV93486.1"
FT                   /translation="MTEESKTYDPVTGEHLKDWGHRPGKQFPALLARANEMRAAGLGLV
FT                   RIRMELEVEIPPAPVTHDLRAPGEVPFHENIDIAGPDEEDNVQKVRETMTALMRTPTIE
FT                   AGAIMPDACPAGPVGTIPVGGVAAARNAIHPGMHSADICCSVMITDLGHADPKTVLDAA
FT                   QSVTHFGPGGRPQGNRFTVSLDLLDAFRANAFLSNPKALRMAQEHLGTQGDGNHFLFVG
FT                   RSRKTGRTAIVTHHGSRGPGAVLYKLGMEVAERFRRELSPGTAKQNAWIPADTDEGRDY
FT                   WAALQLIRKWTKANHNAIHQATVEAARAEAGDRFWNEHNFVFRRGDIYLHGKGATPAWG
FT                   DYAADATGLTLIPLNMSEPVLVVRGKDAARGLGFSPHGAGRNFSRSEHKRRMGKMTPEA
FT                   MLKAETEGLDIRFHAGGVDASELPSSYKKAGSVVDQIRSYDLAEIEDYIDPYGCIMAGE
FT                   VPPFWAKKKTRR"
     MTEESKTYDP VTGEHLKDWG HRPGKQFPAL LARANEMRAA GLGLVRIRME LEVEIPPAPV        60
     THDLRAPGEV PFHENIDIAG PDEEDNVQKV RETMTALMRT PTIEAGAIMP DACPAGPVGT       120
     IPVGGVAAAR NAIHPGMHSA DICCSVMITD LGHADPKTVL DAAQSVTHFG PGGRPQGNRF       180
     TVSLDLLDAF RANAFLSNPK ALRMAQEHLG TQGDGNHFLF VGRSRKTGRT AIVTHHGSRG       240
     PGAVLYKLGM EVAERFRREL SPGTAKQNAW IPADTDEGRD YWAALQLIRK WTKANHNAIH       300
     QATVEAARAE AGDRFWNEHN FVFRRGDIYL HGKGATPAWG DYAADATGLT LIPLNMSEPV       360
     LVVRGKDAAR GLGFSPHGAG RNFSRSEHKR RMGKMTPEAM LKAETEGLDI RFHAGGVDAS       420
     ELPSSYKKAG SVVDQIRSYD LAEIEDYIDP YGCIMAGEVP PFWAKKKTRR                  470
//

If you have problems or comments...

PBIL Back to PBIL home page