(data stored in ACNUC9435 zone)

EMBL: CP000031.PE157

CP000031.PE157       Location/Qualifiers
FT   CDS             complement(178533..179147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0161"
FT                   /product="DNA-binding response regulator, LuxR family"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93487"
FT                   /db_xref="GOA:Q5LWW0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWW0"
FT                   /protein_id="AAV93487.1"
FT                   /translation="MRILLADDHALVRDTISVYLQSEGDAEVVAVPDLGAAMRAADTEG
FT                   PFDLILLDFNMPGMNGLDGLRAAIRHAPDTPVALLSGSAPNRVAQEAVDAGAAGFVPKT
FT                   LAAKSLLHAVRFMIAGEVFVPSTVLQAPEAPSDGGLTATLSRREKQVLGGLCRGLPNKE
FT                   IARELDLQEVTIKLHVRTLCKKLNAKNRTQAAMIARDAGFE"
     MRILLADDHA LVRDTISVYL QSEGDAEVVA VPDLGAAMRA ADTEGPFDLI LLDFNMPGMN        60
     GLDGLRAAIR HAPDTPVALL SGSAPNRVAQ EAVDAGAAGF VPKTLAAKSL LHAVRFMIAG       120
     EVFVPSTVLQ APEAPSDGGL TATLSRREKQ VLGGLCRGLP NKEIARELDL QEVTIKLHVR       180
     TLCKKLNAKN RTQAAMIARD AGFE                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page