(data stored in ACNUC7421 zone)

EMBL: CP000031.PE158

CP000031.PE158       Location/Qualifiers
FT   CDS             179479..179967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0162"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAQ59886.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0162"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93488"
FT                   /db_xref="GOA:Q5LWV9"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWV9"
FT                   /protein_id="AAV93488.1"
FT                   /translation="MRMRAIGRVPILVAGLLLASVGQVAKAGEEVLAVTGSDGSAISFD
FT                   LDALRALPVSEIRTSTIWTDGIQVFQGVSLRDLLDHVDAVEGTITAVALNDYLIDIPTS
FT                   DATRPGPVVAYLRNGEQMSVRDKGPLWIIYPYDDNPDYNTEEYYARSIWQLIRLEVPK"
     MRMRAIGRVP ILVAGLLLAS VGQVAKAGEE VLAVTGSDGS AISFDLDALR ALPVSEIRTS        60
     TIWTDGIQVF QGVSLRDLLD HVDAVEGTIT AVALNDYLID IPTSDATRPG PVVAYLRNGE       120
     QMSVRDKGPL WIIYPYDDNP DYNTEEYYAR SIWQLIRLEV PK                          162
//

If you have problems or comments...

PBIL Back to PBIL home page