(data stored in ACNUC9435 zone)

EMBL: CP000031.PE159

CP000031.PE159       Location/Qualifiers
FT   CDS             180023..182494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0163"
FT                   /product="sensory box histidine kinase/response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00512; match to protein
FT                   family HMM PF00989; match to protein family HMM PF02518;
FT                   match to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93489"
FT                   /db_xref="GOA:Q5LWV8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWV8"
FT                   /protein_id="AAV93489.1"
FT                   /translation="MKTGFWIALVLVLIGYSALLGREAMVRLDTLSTAASDDIRWNMSQ
FT                   LEVELLRLQSAALKARDGGQGDIQQLRTRFDIFYSRTQIVLRGALYDQAREIPEVQERL
FT                   QSLRAFLAESVPIIDAPEPILADRLPELAHLVEQVSPEVRDLALTIVNTSARAADTQRL
FT                   KVSETLRRLALSVLGLLVALTIVALLLLRLYRSSQVVSAEKEAVKSRFEAAVKSALDAV
FT                   LVVDTEGHIIEFNGGAEAMFGYSRSEALGQPMSDLIIPPHYRARHEEGMRRFREHGTSR
FT                   VVGRGHLRLEGMRKSGEVFPIELSISLAETSDQLVFISFLRDITNRLKTEDDLREARDT
FT                   AQAGAQAKAQLLTVMSHEMRTPLNGILGSLDLMERDELSPKQVRLVRAIRVSGELLLTQ
FT                   VNRVLDLSRLESGMIEFPKEPFALLPMVRRLTESLTAAAEERGNRLQTTLVGDDPGVVL
FT                   GNRIALQQALVNLLGNAIKFTRNGEISLEVERLNDDRMIEFRISDTGLGIPAKDIERIF
FT                   DEFVTIDTAYARENPGTGLGLSITRRLVWAMGGEIEVESIEHEGSLFLIRLPLEPGEAV
FT                   ELASEKERGQPEPGPLKGKRVLVIEDNDINRMLLLDMLEEFGCQVVLARDGFEGVAAAK
FT                   SARYDLLLVDISMPGKDGLETLREIRAQEGPNGPVRAIAITANVRDEDKERFAAAGFDG
FT                   FLAKPISMLQLQEMLSGLLLRPEAEAERSTAREFIRRFGMAEYQRHLLGMVDALHAVCD
FT                   DLANTELSETLKARVHEQAGSAAILGRADLHSLLQEIEATDAADWPARRGGMLDRLKTE
FT                   LARTRAVSLGG"
     MKTGFWIALV LVLIGYSALL GREAMVRLDT LSTAASDDIR WNMSQLEVEL LRLQSAALKA        60
     RDGGQGDIQQ LRTRFDIFYS RTQIVLRGAL YDQAREIPEV QERLQSLRAF LAESVPIIDA       120
     PEPILADRLP ELAHLVEQVS PEVRDLALTI VNTSARAADT QRLKVSETLR RLALSVLGLL       180
     VALTIVALLL LRLYRSSQVV SAEKEAVKSR FEAAVKSALD AVLVVDTEGH IIEFNGGAEA       240
     MFGYSRSEAL GQPMSDLIIP PHYRARHEEG MRRFREHGTS RVVGRGHLRL EGMRKSGEVF       300
     PIELSISLAE TSDQLVFISF LRDITNRLKT EDDLREARDT AQAGAQAKAQ LLTVMSHEMR       360
     TPLNGILGSL DLMERDELSP KQVRLVRAIR VSGELLLTQV NRVLDLSRLE SGMIEFPKEP       420
     FALLPMVRRL TESLTAAAEE RGNRLQTTLV GDDPGVVLGN RIALQQALVN LLGNAIKFTR       480
     NGEISLEVER LNDDRMIEFR ISDTGLGIPA KDIERIFDEF VTIDTAYARE NPGTGLGLSI       540
     TRRLVWAMGG EIEVESIEHE GSLFLIRLPL EPGEAVELAS EKERGQPEPG PLKGKRVLVI       600
     EDNDINRMLL LDMLEEFGCQ VVLARDGFEG VAAAKSARYD LLLVDISMPG KDGLETLREI       660
     RAQEGPNGPV RAIAITANVR DEDKERFAAA GFDGFLAKPI SMLQLQEMLS GLLLRPEAEA       720
     ERSTAREFIR RFGMAEYQRH LLGMVDALHA VCDDLANTEL SETLKARVHE QAGSAAILGR       780
     ADLHSLLQEI EATDAADWPA RRGGMLDRLK TELARTRAVS LGG                         823
//

If you have problems or comments...

PBIL Back to PBIL home page