(data stored in ACNUC7421 zone)

EMBL: CP000031.PE16

CP000031.PE16        Location/Qualifiers
FT   CDS             complement(16332..16613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0016"
FT                   /product="sterol carrier family protein"
FT                   /note="identified by match to protein family HMM PF02036"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0016"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93347"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR039543"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWG5"
FT                   /protein_id="AAV93347.1"
FT                   /translation="MLQDIADKMQTELAGKSFDGSLKFDCGDDGVIVLADNTASTQDRD
FT                   TDCTIRLSQDNLVKLLTGKLNPMTGVMMGKLKISGNMGVAMKLGQLLG"
     MLQDIADKMQ TELAGKSFDG SLKFDCGDDG VIVLADNTAS TQDRDTDCTI RLSQDNLVKL        60
     LTGKLNPMTG VMMGKLKISG NMGVAMKLGQ LLG                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page