(data stored in ACNUC7421 zone)

EMBL: CP000031.PE162

CP000031.PE162       Location/Qualifiers
FT   CDS             complement(185200..187245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0166"
FT                   /product="N-methylproline demethylase, putative"
FT                   /note="identified by similarity to SP:O87278; match to
FT                   protein family HMM PF00724"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93492"
FT                   /db_xref="GOA:Q5LWW9"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWW9"
FT                   /protein_id="AAV93492.1"
FT                   /translation="MSRDPLLQPFQLKHLTLKNRIMTTAHEPAYPEDGMPKQRYAAYHA
FT                   ERARAGVALAMTAGSAAVSRDSPPVFNNILAYKDEVVPWIRQLTDACHDHGCAVMIQLT
FT                   HLGRRTGWNKGEWLPSVSSSRHREPAHRAFPKLAEDWDIARIISDFADAAERMKEGGMD
FT                   GIELQVYGHLLDQFWSPLTNDLDGPYGGQTLESRMKMPLDVLRAVRARVGDDFIVGLRY
FT                   TADEAAEGGIGPEEGIEISKRLADTGMVDFLNVIRGRIHTDPAMTDVIPVQGMKSAPHL
FT                   DFAGEVKKATGMPTFHAARIPDVATARHAVASGLLDMVGMTRAHMADPHIVQKIVEGRE
FT                   DDIRPCVGATYCLDRIYQAGEALCIHNPATGRELTMPHTIPSAQTRKRVVVVGAGPAGL
FT                   EAARVAAERGHHVTVFEAQPDPGGQVRLTAQNPRRREMIGIIDWRMAQCAARDVEFRFN
FT                   TWAEAADVTALNPDVVIVATGGLPNTELFETGRENNLVVSAWDLISGDVKPAQNVLIYD
FT                   ESGDHPALMAAEVAANAGAKVEVMTPDRMFAPDIMGMNLVPYMRALQDKDTTFTVTRRL
FT                   LDVTRDGNQLRARIGTDYSSFTKDQTYDQVVVNYGTMPMADLYFELRPLSRNGGEVDYD
FT                   ALIAGNPQTVETNLDGAFQLFRIGDAVSARNTHAAIYDALRLMKDI"
     MSRDPLLQPF QLKHLTLKNR IMTTAHEPAY PEDGMPKQRY AAYHAERARA GVALAMTAGS        60
     AAVSRDSPPV FNNILAYKDE VVPWIRQLTD ACHDHGCAVM IQLTHLGRRT GWNKGEWLPS       120
     VSSSRHREPA HRAFPKLAED WDIARIISDF ADAAERMKEG GMDGIELQVY GHLLDQFWSP       180
     LTNDLDGPYG GQTLESRMKM PLDVLRAVRA RVGDDFIVGL RYTADEAAEG GIGPEEGIEI       240
     SKRLADTGMV DFLNVIRGRI HTDPAMTDVI PVQGMKSAPH LDFAGEVKKA TGMPTFHAAR       300
     IPDVATARHA VASGLLDMVG MTRAHMADPH IVQKIVEGRE DDIRPCVGAT YCLDRIYQAG       360
     EALCIHNPAT GRELTMPHTI PSAQTRKRVV VVGAGPAGLE AARVAAERGH HVTVFEAQPD       420
     PGGQVRLTAQ NPRRREMIGI IDWRMAQCAA RDVEFRFNTW AEAADVTALN PDVVIVATGG       480
     LPNTELFETG RENNLVVSAW DLISGDVKPA QNVLIYDESG DHPALMAAEV AANAGAKVEV       540
     MTPDRMFAPD IMGMNLVPYM RALQDKDTTF TVTRRLLDVT RDGNQLRARI GTDYSSFTKD       600
     QTYDQVVVNY GTMPMADLYF ELRPLSRNGG EVDYDALIAG NPQTVETNLD GAFQLFRIGD       660
     AVSARNTHAA IYDALRLMKD I                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page