(data stored in ACNUC7421 zone)

EMBL: CP000031.PE163

CP000031.PE163       Location/Qualifiers
FT   CDS             complement(187255..188823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0167"
FT                   /product="trimethylamine methyltransferase family protein"
FT                   /note="identified by match to protein family HMM PF06253"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93493"
FT                   /db_xref="GOA:Q5LWW8"
FT                   /db_xref="InterPro:IPR010426"
FT                   /db_xref="InterPro:IPR038601"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWW8"
FT                   /protein_id="AAV93493.1"
FT                   /translation="MSEQTPLRSRRSRRASGKAGRSAEPGQNLHLRVPYITRKIPTYDL
FT                   LGEESLDKIEATADRILAEIGIELRDDEESMRLYKRAGAQVTELRADAWNIRFEPGMLR
FT                   EILKTAPARFTQHARNPANNVDIGGDAMVFAPAYGSPFVMDMDNGRRYGTIQDFQNLIK
FT                   LGQSSPWLHHSGGTICEPTDIPVNKRHLDMVYSHMRYSDRAFLGSITAPERAADSVEMC
FT                   RILFGADFVDQNCVIMGNFNTTSPLVIDGVTAAGIRTYAAAGQGSIHLPFLLGGAVSPL
FT                   TMAGAVAQCLAESMASSALTQLVRPGAPAILAGFLSSMSLRSGSPTFGTPEPALGSLVM
FT                   GQLARRLNMPLRCAGNFSTSKAPDGQAMQQAMMSMMSAVQGGANYILHSAGFVDGLLSM
FT                   SYEKFVMDTDMCGALHSYLAGIEVNEDTLGFDALAQNGPGEHLFGTDHTLRHYETAYWD
FT                   SGLNDDQTHETWSEQGSADYAIRANKRWKDILNTYEAPVMDDATDEALREFIDRKKASM
FT                   PDAWY"
     MSEQTPLRSR RSRRASGKAG RSAEPGQNLH LRVPYITRKI PTYDLLGEES LDKIEATADR        60
     ILAEIGIELR DDEESMRLYK RAGAQVTELR ADAWNIRFEP GMLREILKTA PARFTQHARN       120
     PANNVDIGGD AMVFAPAYGS PFVMDMDNGR RYGTIQDFQN LIKLGQSSPW LHHSGGTICE       180
     PTDIPVNKRH LDMVYSHMRY SDRAFLGSIT APERAADSVE MCRILFGADF VDQNCVIMGN       240
     FNTTSPLVID GVTAAGIRTY AAAGQGSIHL PFLLGGAVSP LTMAGAVAQC LAESMASSAL       300
     TQLVRPGAPA ILAGFLSSMS LRSGSPTFGT PEPALGSLVM GQLARRLNMP LRCAGNFSTS       360
     KAPDGQAMQQ AMMSMMSAVQ GGANYILHSA GFVDGLLSMS YEKFVMDTDM CGALHSYLAG       420
     IEVNEDTLGF DALAQNGPGE HLFGTDHTLR HYETAYWDSG LNDDQTHETW SEQGSADYAI       480
     RANKRWKDIL NTYEAPVMDD ATDEALREFI DRKKASMPDA WY                          522
//

If you have problems or comments...

PBIL Back to PBIL home page