(data stored in ACNUC9435 zone)

EMBL: CP000031.PE164

CP000031.PE164       Location/Qualifiers
FT   CDS             188930..189568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0168"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93494"
FT                   /db_xref="GOA:Q5LWW7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWW7"
FT                   /protein_id="AAV93494.1"
FT                   /translation="MSLAPKPTGSESAWLDAAYELLTESGVEAVKIMPLAQKLGVSRTG
FT                   FYWYFKDRETLLEAMIQRWEEKNTGNLVARAEAYAESIVEAMFNLFDCWLDDGLFDARL
FT                   DLAIRNWARNDPGLHQRLDQADQARQDAVAGMFLRFGYPENQARVRSLTVMYTQVGYIS
FT                   MQIEEHPDIRIANMPDYVEVFTGVTPDQADVDRFLSRHAAKWRAAANQM"
     MSLAPKPTGS ESAWLDAAYE LLTESGVEAV KIMPLAQKLG VSRTGFYWYF KDRETLLEAM        60
     IQRWEEKNTG NLVARAEAYA ESIVEAMFNL FDCWLDDGLF DARLDLAIRN WARNDPGLHQ       120
     RLDQADQARQ DAVAGMFLRF GYPENQARVR SLTVMYTQVG YISMQIEEHP DIRIANMPDY       180
     VEVFTGVTPD QADVDRFLSR HAAKWRAAAN QM                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page