(data stored in ACNUC9435 zone)

EMBL: CP000031.PE165

CP000031.PE165       Location/Qualifiers
FT   CDS             189622..190320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0169"
FT                   /product="transglycosylase, Slt family"
FT                   /note="identified by match to protein family HMM PF01464"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0169"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93495"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWW6"
FT                   /protein_id="AAV93495.1"
FT                   /translation="MPLNLITRFAAFVWLSVLFAAAPALAKLDPGVSSLCDQAARSAAN
FT                   RHGVPLDVLRAITRVETGRRSDGQLAPWPWTVNMEGTGHWFPTEFAARKFVFERFKSGA
FT                   RSFDVGCFQINYRWHSQGFSSIEEMFDPERNADYAARFLNDLFGELGSWSAAAGAYHSR
FT                   TQSLADAYASRFDRTRAALGEGPMPNPHRTPDTGGAQPLFARQEAPPGPARLGSLFATG
FT                   SGARPFISFN"
     MPLNLITRFA AFVWLSVLFA AAPALAKLDP GVSSLCDQAA RSAANRHGVP LDVLRAITRV        60
     ETGRRSDGQL APWPWTVNME GTGHWFPTEF AARKFVFERF KSGARSFDVG CFQINYRWHS       120
     QGFSSIEEMF DPERNADYAA RFLNDLFGEL GSWSAAAGAY HSRTQSLADA YASRFDRTRA       180
     ALGEGPMPNP HRTPDTGGAQ PLFARQEAPP GPARLGSLFA TGSGARPFIS FN               232
//

If you have problems or comments...

PBIL Back to PBIL home page