(data stored in ACNUC7421 zone)

EMBL: CP000031.PE170

CP000031.PE170       Location/Qualifiers
FT   CDS             complement(194774..195310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0174"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0174"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93500"
FT                   /db_xref="GOA:Q5LWW3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWW3"
FT                   /protein_id="AAV93500.1"
FT                   /translation="MLGKLLPVLFLVVGLGAGVGAGVFLGPKPSQDSAHASDQASDHGE
FT                   EKPSKAKPGDQAKSEPSEDHDAEDSGNEYVKMNKPFVVPLVHKDQISGLATVSLSLEVQ
FT                   PGFSENFYAKEPKLRDGFLQVLFDHANIGGFDGAFTRPGNLDPLRVALLESAQKAFGDN
FT                   IVSVLIVDIARQDSY"
     MLGKLLPVLF LVVGLGAGVG AGVFLGPKPS QDSAHASDQA SDHGEEKPSK AKPGDQAKSE        60
     PSEDHDAEDS GNEYVKMNKP FVVPLVHKDQ ISGLATVSLS LEVQPGFSEN FYAKEPKLRD       120
     GFLQVLFDHA NIGGFDGAFT RPGNLDPLRV ALLESAQKAF GDNIVSVLIV DIARQDSY         178
//

If you have problems or comments...

PBIL Back to PBIL home page