(data stored in ACNUC7421 zone)

EMBL: CP000031.PE180

CP000031.PE180       Location/Qualifiers
FT   CDS             complement(200811..202328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0184"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF01970"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93510"
FT                   /db_xref="GOA:Q5LWY6"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWY6"
FT                   /protein_id="AAV93510.1"
FT                   /translation="MLEGLMIGLGTAFSLTNILMVIGGCLIGTFIGMLPGLGPMSIIAI
FT                   MIPVAITIGDPSAALILLAGVYYGAIFGGSTSSILINAPGVASTVATSFDGYPLARQGK
FT                   AGKALTVAAISSFCGGTIGAILLMVFAPALASVALLFHSAEYFALMVVGLSAIAAFAGS
FT                   GQVGKALLMTLLGLIMATVGEGALFNMPRFTMGVMDLQSGFGFITLAMAMFALPEALYL
FT                   VLDPSRSTQGGESGEIKDLRITRAEAKSIAPVIGRQSVQGFLIGVLPGAGATIASFLGY
FT                   AVERNIAPKAEQEEFGKGSLKGLAAPESANNAACTGSFVPLLTLGIPGSGTTAILLGAL
FT                   IALNVTPGPRLMVDDPQIFWAVIISMYLGNLILLILNLPLIPYIAKILAVPRSFLIPFI
FT                   LFFTLMGAYIGQNNSTELLILVGLGVCATVLRFADYPLAPLLIGFILGSMLENNFARAM
FT                   QLYDGLGFILERPMTVGLLVLAALLVILPSYRARRARLRAEGVADAD"
     MLEGLMIGLG TAFSLTNILM VIGGCLIGTF IGMLPGLGPM SIIAIMIPVA ITIGDPSAAL        60
     ILLAGVYYGA IFGGSTSSIL INAPGVASTV ATSFDGYPLA RQGKAGKALT VAAISSFCGG       120
     TIGAILLMVF APALASVALL FHSAEYFALM VVGLSAIAAF AGSGQVGKAL LMTLLGLIMA       180
     TVGEGALFNM PRFTMGVMDL QSGFGFITLA MAMFALPEAL YLVLDPSRST QGGESGEIKD       240
     LRITRAEAKS IAPVIGRQSV QGFLIGVLPG AGATIASFLG YAVERNIAPK AEQEEFGKGS       300
     LKGLAAPESA NNAACTGSFV PLLTLGIPGS GTTAILLGAL IALNVTPGPR LMVDDPQIFW       360
     AVIISMYLGN LILLILNLPL IPYIAKILAV PRSFLIPFIL FFTLMGAYIG QNNSTELLIL       420
     VGLGVCATVL RFADYPLAPL LIGFILGSML ENNFARAMQL YDGLGFILER PMTVGLLVLA       480
     ALLVILPSYR ARRARLRAEG VADAD                                             505
//

If you have problems or comments...

PBIL Back to PBIL home page