(data stored in ACNUC7421 zone)

EMBL: CP000031.PE182

CP000031.PE182       Location/Qualifiers
FT   CDS             complement(203121..204098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0186"
FT                   /product="bordetella uptake gene family protein"
FT                   /note="identified by match to protein family HMM PF03401"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93512"
FT                   /db_xref="GOA:Q5LWY4"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWY4"
FT                   /protein_id="AAV93512.1"
FT                   /translation="MKTNLTRRVMMAAASAAFAFSTPSWAEPVVDSIHFLIPGGAGGGW
FT                   DGTARGTGEALTAAGLAGTASYENMSGGGGGKAIGYLIENAASNHGTLMVNSTPIIIRS
FT                   LTGVFPQNFRDLTLVAGTIGDYAAIVVGKDSPVNSMTDLLASFDADPSGTAIGGGSVPG
FT                   GMDHLVAAMVMEAAGKDSLAVKYIAYDAGGKAMAALLSGEIAALSTGFSEAVDLANAGE
FT                   VKIIGVTSDDRVAAYPDAPTMKEQGIDTTFVNWRGFFGAPGLPEDRLAAYQEAIAKMYD
FT                   TPEWEAVRARNGWVNIHNSGDDFRAFLEKQEQQIGDLMRKLGFL"
     MKTNLTRRVM MAAASAAFAF STPSWAEPVV DSIHFLIPGG AGGGWDGTAR GTGEALTAAG        60
     LAGTASYENM SGGGGGKAIG YLIENAASNH GTLMVNSTPI IIRSLTGVFP QNFRDLTLVA       120
     GTIGDYAAIV VGKDSPVNSM TDLLASFDAD PSGTAIGGGS VPGGMDHLVA AMVMEAAGKD       180
     SLAVKYIAYD AGGKAMAALL SGEIAALSTG FSEAVDLANA GEVKIIGVTS DDRVAAYPDA       240
     PTMKEQGIDT TFVNWRGFFG APGLPEDRLA AYQEAIAKMY DTPEWEAVRA RNGWVNIHNS       300
     GDDFRAFLEK QEQQIGDLMR KLGFL                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page