(data stored in ACNUC7421 zone)

EMBL: CP000031.PE183

CP000031.PE183       Location/Qualifiers
FT   CDS             204208..204873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0187"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93513"
FT                   /db_xref="GOA:Q5LWY3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWY3"
FT                   /protein_id="AAV93513.1"
FT                   /translation="MRFLLVEDNQSLASAILDRLRLDGHVVDHAANISLAEEFVITTDY
FT                   DLILLDIMLPDGDGRSFLKMQRDHRSETPVIVLTARSEVSDRVGVLDLGADDYLTKPFD
FT                   FSELEARCRAVLRRRGGRSSNQKRIGGLTFDPLSGLLEVCGLEVPLRNKELRLLEIFLA
FT                   APDQIFSKARLVDRLFSYDEEVSENAIEVYVGRLRKKIAGSGVEIQTVRGLGYRIRLQ"
     MRFLLVEDNQ SLASAILDRL RLDGHVVDHA ANISLAEEFV ITTDYDLILL DIMLPDGDGR        60
     SFLKMQRDHR SETPVIVLTA RSEVSDRVGV LDLGADDYLT KPFDFSELEA RCRAVLRRRG       120
     GRSSNQKRIG GLTFDPLSGL LEVCGLEVPL RNKELRLLEI FLAAPDQIFS KARLVDRLFS       180
     YDEEVSENAI EVYVGRLRKK IAGSGVEIQT VRGLGYRIRL Q                           221
//

If you have problems or comments...

PBIL Back to PBIL home page