(data stored in ACNUC9435 zone)

EMBL: CP000031.PE185

CP000031.PE185       Location/Qualifiers
FT   CDS             206225..207250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0189"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAM42620.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93515"
FT                   /db_xref="GOA:Q5LWY1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWY1"
FT                   /protein_id="AAV93515.1"
FT                   /translation="MRLSALSLCLTLWAAIAGAFEVEEHALFGAADGRVLRILSTTDTH
FT                   ILRPLIDSFLDARPGVAVDYLSVSSAEVMRAIVDEGERFDLVLSSAMDLQIKLANDGYT
FT                   RPHRSAWTPLVPDWGNWRDHVFAFSQETASVVLSRAAFADQDLPRTRQDLIDLLRSDPD
FT                   RFQGRVGTYDVAVSGLGYLFATQDARTAESYWRLMEVLGGLQVKLYCCSGEMIEAVAEG
FT                   RIDMAYNVLGSYARARTDLAESILVIEPEEYTNMMMRTAVIMRDAAEPDLAGAFADHLI
FT                   AAAWSDPPAPDYPFPGPPATDRPEGASLRPISLGPGLLVFLDRLKRQRFLEEWRNAVQQ
FT                   E"
     MRLSALSLCL TLWAAIAGAF EVEEHALFGA ADGRVLRILS TTDTHILRPL IDSFLDARPG        60
     VAVDYLSVSS AEVMRAIVDE GERFDLVLSS AMDLQIKLAN DGYTRPHRSA WTPLVPDWGN       120
     WRDHVFAFSQ ETASVVLSRA AFADQDLPRT RQDLIDLLRS DPDRFQGRVG TYDVAVSGLG       180
     YLFATQDART AESYWRLMEV LGGLQVKLYC CSGEMIEAVA EGRIDMAYNV LGSYARARTD       240
     LAESILVIEP EEYTNMMMRT AVIMRDAAEP DLAGAFADHL IAAAWSDPPA PDYPFPGPPA       300
     TDRPEGASLR PISLGPGLLV FLDRLKRQRF LEEWRNAVQQ E                           341
//

If you have problems or comments...

PBIL Back to PBIL home page