(data stored in ACNUC9435 zone)

EMBL: CP000031.PE186

CP000031.PE186       Location/Qualifiers
FT   CDS             207330..208943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0190"
FT                   /product="oxidoreductase, GMC family"
FT                   /note="identified by match to protein family HMM PF00732;
FT                   match to protein family HMM PF05199"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93516"
FT                   /db_xref="GOA:Q5LWY0"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWY0"
FT                   /protein_id="AAV93516.1"
FT                   /translation="MTFDYVIVGGGSAGSALAARLSEDPGRTVCLIEAGGRGDSLLIRA
FT                   PAAVVAMLPGRPRINNWAYETVPQPGLNGRRGYQPRGKALGGSSAINAMLYVRGHRRDY
FT                   DEWAELGCDGWSWDEVLPYFRKSENNQRGADPMHGGSGPLQVSDQQSPRPISRAFVEAG
FT                   AAMQIRQSDDFNTGDNEGIGLYQVTQFHKPGHQGERCSAALAYLYPVMGRPNLTVITRA
FT                   HAKQVLFEGKRAIGVRYRKAGQSHTARAACEVILCGGAFNSPQMLQLSGVGRPEDIAPH
FT                   GIAMVHELPGVGQNLQDHLDFTLAYKSRDTDNFGLGLAGAVNLLRHARAWRRDGSGMIA
FT                   TPFAEGGAFFKTDPGLERPDIQLHFVISIVDDHARKLHMGYGFSCHVCVLRPGSRGTVS
FT                   LASADPLAAPVIDPQFLSDPADLSALMKGVRKTREMMRSQPLSGYIHKELFIDGEPDDA
FT                   GLEQHIRARADTIYHPVGTCRMGRDEMAVVDPQLRVHGVEGLRVVDASVMPRLIGGNTN
FT                   APTIMIAEKAADMIRAAAQA"
     MTFDYVIVGG GSAGSALAAR LSEDPGRTVC LIEAGGRGDS LLIRAPAAVV AMLPGRPRIN        60
     NWAYETVPQP GLNGRRGYQP RGKALGGSSA INAMLYVRGH RRDYDEWAEL GCDGWSWDEV       120
     LPYFRKSENN QRGADPMHGG SGPLQVSDQQ SPRPISRAFV EAGAAMQIRQ SDDFNTGDNE       180
     GIGLYQVTQF HKPGHQGERC SAALAYLYPV MGRPNLTVIT RAHAKQVLFE GKRAIGVRYR       240
     KAGQSHTARA ACEVILCGGA FNSPQMLQLS GVGRPEDIAP HGIAMVHELP GVGQNLQDHL       300
     DFTLAYKSRD TDNFGLGLAG AVNLLRHARA WRRDGSGMIA TPFAEGGAFF KTDPGLERPD       360
     IQLHFVISIV DDHARKLHMG YGFSCHVCVL RPGSRGTVSL ASADPLAAPV IDPQFLSDPA       420
     DLSALMKGVR KTREMMRSQP LSGYIHKELF IDGEPDDAGL EQHIRARADT IYHPVGTCRM       480
     GRDEMAVVDP QLRVHGVEGL RVVDASVMPR LIGGNTNAPT IMIAEKAADM IRAAAQA          537
//

If you have problems or comments...

PBIL Back to PBIL home page