(data stored in ACNUC7421 zone)

EMBL: CP000031.PE189

CP000031.PE189       Location/Qualifiers
FT   CDS             211299..212750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0193"
FT                   /product="flagellar hook-associated protein FlgK, putative"
FT                   /note="identified by similarity to SP:P33235; match to
FT                   protein family HMM PF00460; match to protein family HMM
FT                   PF06429"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0193"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93519"
FT                   /db_xref="GOA:Q5LWZ4"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWZ4"
FT                   /protein_id="AAV93519.1"
FT                   /translation="MTISAALNSALSGLTAASRATGVASDNIANALTPGYARRSLEVAG
FT                   NTIGGAGVRILGVVRNSDPVLLASRRGADAAQGYADGVSGFHTRMARLVGNVNDPRSVP
FT                   NLIAEFESSLIAAASTPSVQTRLDAVATAASELATALNAASNGLREARNDADRSIGQQV
FT                   DRLNTVLQNVETLNGRIQSVKLSGGDSAPLLDQRQKLIDEVNTMIPVNVVARDHGSVAL
FT                   FTDGGAILLDGPAAQLSFTPTLQTMPHMTLENGLLSGLELNGMPLRLSGPTSAIRGGSL
FT                   AAAFEVRDDLAIEAQQDLDAVARDLIERFEAPGLDPTAAPTDAGLFTDNGARFSASAQT
FT                   GLAGRLKLNASVDPGQGGQSWRLRDGLGAAVPGAVGNAQQINAFHQALTATRTPSDPRF
FT                   GTGDMTANQVGAALLSRVAQNESLATERLTFASASRTEMQKLELEQGVDTDVELQMLMQ
FT                   IEQAYAANARMIETVGEMMDTLLRL"
     MTISAALNSA LSGLTAASRA TGVASDNIAN ALTPGYARRS LEVAGNTIGG AGVRILGVVR        60
     NSDPVLLASR RGADAAQGYA DGVSGFHTRM ARLVGNVNDP RSVPNLIAEF ESSLIAAAST       120
     PSVQTRLDAV ATAASELATA LNAASNGLRE ARNDADRSIG QQVDRLNTVL QNVETLNGRI       180
     QSVKLSGGDS APLLDQRQKL IDEVNTMIPV NVVARDHGSV ALFTDGGAIL LDGPAAQLSF       240
     TPTLQTMPHM TLENGLLSGL ELNGMPLRLS GPTSAIRGGS LAAAFEVRDD LAIEAQQDLD       300
     AVARDLIERF EAPGLDPTAA PTDAGLFTDN GARFSASAQT GLAGRLKLNA SVDPGQGGQS       360
     WRLRDGLGAA VPGAVGNAQQ INAFHQALTA TRTPSDPRFG TGDMTANQVG AALLSRVAQN       420
     ESLATERLTF ASASRTEMQK LELEQGVDTD VELQMLMQIE QAYAANARMI ETVGEMMDTL       480
     LRL                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page