(data stored in ACNUC7421 zone)

EMBL: CP000031.PE19

CP000031.PE19        Location/Qualifiers
FT   CDS             18450..19280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0019"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93350"
FT                   /db_xref="GOA:Q5LWG2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWG2"
FT                   /protein_id="AAV93350.1"
FT                   /translation="MKQQSATQVMVEGCFKMLGWRIFLYSIRMVLRNWRHALRLALVPA
FT                   ILGSVAMMTIAWVMQSGPAFEQFFGAGLNDLDKTEMTRQHTLSSLLVLVPQAVASLWIV
FT                   ITWHRFILLEEAQDGWVPPLRPGRTLAYFALSVGIVLIFAAVAFPVVYATVVLAAALGL
FT                   RGMAVALTLAVLLLLSPLSQRALLVLPASAIGQPLSFGDALTLTRDHYWTMLIVAVSGS
FT                   AMQHGLSTVLSFVGGTSTVGPVAALFLTLLLQPLLWASVLTTLYGVFVEKRPLG"
     MKQQSATQVM VEGCFKMLGW RIFLYSIRMV LRNWRHALRL ALVPAILGSV AMMTIAWVMQ        60
     SGPAFEQFFG AGLNDLDKTE MTRQHTLSSL LVLVPQAVAS LWIVITWHRF ILLEEAQDGW       120
     VPPLRPGRTL AYFALSVGIV LIFAAVAFPV VYATVVLAAA LGLRGMAVAL TLAVLLLLSP       180
     LSQRALLVLP ASAIGQPLSF GDALTLTRDH YWTMLIVAVS GSAMQHGLST VLSFVGGTST       240
     VGPVAALFLT LLLQPLLWAS VLTTLYGVFV EKRPLG                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page