(data stored in ACNUC7421 zone)

EMBL: CP000031.PE197

CP000031.PE197       Location/Qualifiers
FT   CDS             218871..219290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0201"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAF27716.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93527"
FT                   /db_xref="GOA:Q5LWY7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWY7"
FT                   /protein_id="AAV93527.1"
FT                   /translation="MELIADILLVAGALGAGLYCFVLGRRLKRFNDLERGVGGAVAVLS
FT                   SQVDELNRTLAAAREASDNSGAALGDLTGRAEAVAQRLELMMASMHDVAPAQEVSAPPE
FT                   VVRQEPKPARPDEAKPAPAGVMFMRHDRGNSGTTP"
     MELIADILLV AGALGAGLYC FVLGRRLKRF NDLERGVGGA VAVLSSQVDE LNRTLAAARE        60
     ASDNSGAALG DLTGRAEAVA QRLELMMASM HDVAPAQEVS APPEVVRQEP KPARPDEAKP       120
     APAGVMFMRH DRGNSGTTP                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page