(data stored in ACNUC7421 zone)

EMBL: CP000031.PE200

CP000031.PE200       Location/Qualifiers
FT   CDS             220807..223038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0204"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93530"
FT                   /db_xref="GOA:Q5LX00"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX00"
FT                   /protein_id="AAV93530.1"
FT                   /translation="MMQRILAVFLLLYLALPVAAAEVEVRSGEHQSFTRLVMRIPSQTK
FT                   WTLENSTGSARLKVDLPDLKLDYGEVFDRVPRKRLSELHQEKAGAPLELQFACDCEARA
FT                   FVQGGTLLVIDIRDRPASDPPLVLPLVPERVLASGDGVGADHPIEDREEDSGVAVNPRS
FT                   QPSGGASQHTFLDFSAPMAGERTVENRLYSRIMRGVDQEVLALSPREATDPDDQISAAQ
FT                   AALTETLAAGLGLPNLRVTTVVDRDLRAAREGTASPTIARKCVDDQKLAVPDWADDSPF
FT                   STQYAVLRDGLYGEFDRINAQAALALVRFYIHFGFGDEAKVNLELLQPASPDRQLLASL
FT                   AAAVEGRPAPVDNPLAGLQGCDNDAAMWSVLSERHAPETTNTNAVLRSYGRLPVHLRAY
FT                   LGPVLGEYLTDAGFVDAAQQLVRAVERSDEGDKASIAVVEAKLAGLKNEPAVQEQKLTE
FT                   VIEDASASTHAPLALIDLIEKRWVEGGDVTEQELLLAASFVHEYRRSEIGPQIQTAYVI
FT                   AQALSAQFDEAMKTLLDPGQDRKSQVWRETVDRIVKRITSHGDDITFLRHVAMLESDLF
FT                   LSVNTDTVTQVARRLNDLGFFEDALRYADRPQDRKSRPARVEIIARATLGTGRPHRALL
FT                   ELETASGPEVERLRAQAMREAGALEQAAEALTRAGDLEAASRYLWLAGAEAPIDGGEET
FT                   RFGGIHLMGRALLEEREPSSGTPLAAAREMVDDSARVRDQIDSLLNRLP"
     MMQRILAVFL LLYLALPVAA AEVEVRSGEH QSFTRLVMRI PSQTKWTLEN STGSARLKVD        60
     LPDLKLDYGE VFDRVPRKRL SELHQEKAGA PLELQFACDC EARAFVQGGT LLVIDIRDRP       120
     ASDPPLVLPL VPERVLASGD GVGADHPIED REEDSGVAVN PRSQPSGGAS QHTFLDFSAP       180
     MAGERTVENR LYSRIMRGVD QEVLALSPRE ATDPDDQISA AQAALTETLA AGLGLPNLRV       240
     TTVVDRDLRA AREGTASPTI ARKCVDDQKL AVPDWADDSP FSTQYAVLRD GLYGEFDRIN       300
     AQAALALVRF YIHFGFGDEA KVNLELLQPA SPDRQLLASL AAAVEGRPAP VDNPLAGLQG       360
     CDNDAAMWSV LSERHAPETT NTNAVLRSYG RLPVHLRAYL GPVLGEYLTD AGFVDAAQQL       420
     VRAVERSDEG DKASIAVVEA KLAGLKNEPA VQEQKLTEVI EDASASTHAP LALIDLIEKR       480
     WVEGGDVTEQ ELLLAASFVH EYRRSEIGPQ IQTAYVIAQA LSAQFDEAMK TLLDPGQDRK       540
     SQVWRETVDR IVKRITSHGD DITFLRHVAM LESDLFLSVN TDTVTQVARR LNDLGFFEDA       600
     LRYADRPQDR KSRPARVEII ARATLGTGRP HRALLELETA SGPEVERLRA QAMREAGALE       660
     QAAEALTRAG DLEAASRYLW LAGAEAPIDG GEETRFGGIH LMGRALLEER EPSSGTPLAA       720
     AREMVDDSAR VRDQIDSLLN RLP                                               743
//

If you have problems or comments...

PBIL Back to PBIL home page