(data stored in ACNUC7421 zone)

EMBL: CP000031.PE203

CP000031.PE203       Location/Qualifiers
FT   CDS             complement(225805..228222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0207"
FT                   /product="aminomethyl transferase family protein"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM PF01571"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93533"
FT                   /db_xref="GOA:Q5LWZ7"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="InterPro:IPR032503"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWZ7"
FT                   /protein_id="AAV93533.1"
FT                   /translation="MKTHAQAVVIGGGLVGCSILYHLAKLGWRDVVLLERDELTSGSTW
FT                   HAAANIHGLHDNNNVTRIQHYTMNLYKELEKETGQGCGVFQAGSLYLAQTEAREHQLRL
FT                   QEAKARYYGLNFYEIDKDRAKELHPLAQFDDIRCIMYEPDGGNVDPSGVTYAYAAGARA
FT                   MGATIERFCPVIGTEPQPDGSWIVRTEKGDIHTQWVVNAAGLWGREVAALAGITLPLQP
FT                   TEHQYFVTEAIPEVAALGRRLPSIADRDGEYYFRQEGNGLLIGAYEKDMKFWAENGTPL
FT                   DFAHDLFPDDLDRIMENVIRATERVPVAATAGVKRVINGPMIWSPDSSALWGPVPELRN
FT                   YFVCGGIIPGFSQSGGLGLLAAQWMIEGEPQNDMFAWDLARFGDWADKTFTKARVQDQY
FT                   THRFAIHFPNEERSAGRPARVRPAYEMQQQMGAVFGMNCGWEHPLWFADQPGVSETVGF
FT                   TRQNWWEPVGREARMLREQVGVIDISNFANYEIKGPGAHDWLDRLVANRVPTVEGRSCL
FT                   TPLIGVRGGIAGDFTITMTGEDAYMMVGSGMAERYHQRFFNMVDLPEGTTCEVATNRIA
FT                   GYNVAGPRAREMLQRLTNADLSNAGFPFMRSATIEVAGVACLAIRVSFTGDLGCELHCA
FT                   EGDQVRLYTALIAAAREVGGGPVGSRALGSLRIEKGYGSWGREYSPEYWPQEVGLDRLI
FT                   KADKDFLNKAAWLKIKDYPVREVLSVFEIEAVHGADASGGEPIFTPDGRPAGRVTSGAY
FT                   GYSVGKSLAIGFVNPAVAQPGDVLEVFILGKPHRAVLLAEPPFDPAGARLRG"
     MKTHAQAVVI GGGLVGCSIL YHLAKLGWRD VVLLERDELT SGSTWHAAAN IHGLHDNNNV        60
     TRIQHYTMNL YKELEKETGQ GCGVFQAGSL YLAQTEAREH QLRLQEAKAR YYGLNFYEID       120
     KDRAKELHPL AQFDDIRCIM YEPDGGNVDP SGVTYAYAAG ARAMGATIER FCPVIGTEPQ       180
     PDGSWIVRTE KGDIHTQWVV NAAGLWGREV AALAGITLPL QPTEHQYFVT EAIPEVAALG       240
     RRLPSIADRD GEYYFRQEGN GLLIGAYEKD MKFWAENGTP LDFAHDLFPD DLDRIMENVI       300
     RATERVPVAA TAGVKRVING PMIWSPDSSA LWGPVPELRN YFVCGGIIPG FSQSGGLGLL       360
     AAQWMIEGEP QNDMFAWDLA RFGDWADKTF TKARVQDQYT HRFAIHFPNE ERSAGRPARV       420
     RPAYEMQQQM GAVFGMNCGW EHPLWFADQP GVSETVGFTR QNWWEPVGRE ARMLREQVGV       480
     IDISNFANYE IKGPGAHDWL DRLVANRVPT VEGRSCLTPL IGVRGGIAGD FTITMTGEDA       540
     YMMVGSGMAE RYHQRFFNMV DLPEGTTCEV ATNRIAGYNV AGPRAREMLQ RLTNADLSNA       600
     GFPFMRSATI EVAGVACLAI RVSFTGDLGC ELHCAEGDQV RLYTALIAAA REVGGGPVGS       660
     RALGSLRIEK GYGSWGREYS PEYWPQEVGL DRLIKADKDF LNKAAWLKIK DYPVREVLSV       720
     FEIEAVHGAD ASGGEPIFTP DGRPAGRVTS GAYGYSVGKS LAIGFVNPAV AQPGDVLEVF       780
     ILGKPHRAVL LAEPPFDPAG ARLRG                                             805
//

If you have problems or comments...

PBIL Back to PBIL home page