(data stored in ACNUC7421 zone)

EMBL: CP000031.PE204

CP000031.PE204       Location/Qualifiers
FT   CDS             228804..230498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0209"
FT                   /product="Na/Pi-cotransporter family protein"
FT                   /note="identified by match to protein family HMM PF02690"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0209"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93534"
FT                   /db_xref="GOA:Q5LWZ6"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWZ6"
FT                   /protein_id="AAV93534.1"
FT                   /translation="MQEGFRRAGLKNTGLPPCPSLARLRVRGAQEMAGNLYFLIGGIGM
FT                   FLLGMELMTAALRDTAGSRLRGVLTRFTTTPLRGVMTGAAATAVVQSSSATTVMTVGFV
FT                   GAGLMTMPQALGILYGANIGTTATGWLVSLLGFKLKLGNLALLLLFPAALADLLARGPL
FT                   ARAGRTVAGLCLLLIGLDLMQSGASDLTAYLTPESLPGSGMGGLLLLVGLGATVTIVMQ
FT                   SSSAAMALALVMLSGGAITLLQAAAIVIGMNIGTTFTAVLASTGGSVPMRQTALANLIF
FT                   NIVTSVLAFPLLLLLRPVFESAAGLGDDLSVLLLFHTGFNLVGTALFLPLTGCFAGLVA
FT                   RLLPERESDQLFVPDRSLLKDANAALLAAQSGTRTVAERMFSALGAGLAPAPDYRPIAA
FT                   LTPCVRALEDLRAFLSEIRLPPDRAQDIETFSDILHQIDHLTRLLDRARQTGNIDTLLH
FT                   DRLLRRSALGAGAALRRSGAALGALPEGMRLERLRHLIGARRKRHRRAMMLGEHVGLFS
FT                   LDQVFAHTDAMRWLDRVLHHAERVAHYHRAAAARLPAADAPPRAETG"
     MQEGFRRAGL KNTGLPPCPS LARLRVRGAQ EMAGNLYFLI GGIGMFLLGM ELMTAALRDT        60
     AGSRLRGVLT RFTTTPLRGV MTGAAATAVV QSSSATTVMT VGFVGAGLMT MPQALGILYG       120
     ANIGTTATGW LVSLLGFKLK LGNLALLLLF PAALADLLAR GPLARAGRTV AGLCLLLIGL       180
     DLMQSGASDL TAYLTPESLP GSGMGGLLLL VGLGATVTIV MQSSSAAMAL ALVMLSGGAI       240
     TLLQAAAIVI GMNIGTTFTA VLASTGGSVP MRQTALANLI FNIVTSVLAF PLLLLLRPVF       300
     ESAAGLGDDL SVLLLFHTGF NLVGTALFLP LTGCFAGLVA RLLPERESDQ LFVPDRSLLK       360
     DANAALLAAQ SGTRTVAERM FSALGAGLAP APDYRPIAAL TPCVRALEDL RAFLSEIRLP       420
     PDRAQDIETF SDILHQIDHL TRLLDRARQT GNIDTLLHDR LLRRSALGAG AALRRSGAAL       480
     GALPEGMRLE RLRHLIGARR KRHRRAMMLG EHVGLFSLDQ VFAHTDAMRW LDRVLHHAER       540
     VAHYHRAAAA RLPAADAPPR AETG                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page