(data stored in ACNUC9435 zone)

EMBL: CP000031.PE208

CP000031.PE208       Location/Qualifiers
FT   CDS             complement(233547..234620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0213"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAM40439.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0213"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93538"
FT                   /db_xref="GOA:Q5LX09"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX09"
FT                   /protein_id="AAV93538.1"
FT                   /translation="MIRLAALVLCLLPVAAAAEVLRVATFNTELSRKGPGLMLRDIAGG
FT                   RDTQVAAVVSVIASARPDILALQGLDWDHEGRALDALAAQLAAAGWEMAHIFAAQPNSG
FT                   RATDLDLDGDRRIGGPGDAQGYGRFTGQGGIAILSRHPIAQAEIQDFSALRWRDLPGAT
FT                   LPESGGHAFPSEAAQAAQRLSSTGHWLVPIDTDMGRMVLLTYQAGPPVFDGPEDRNGLR
FT                   NRDETRFWQLLLDGVVGAMPDLPFVLAGGANLDPQDGEGYRGTIRALLADPRLQDPAPE
FT                   SSGAARAGPQGHAGPDARDTVDWPGIGRFRVDYVLPSTHWRVVGSGVVWPAPDDPSAGP
FT                   VSEASRHRLVWVDLSRQ"
     MIRLAALVLC LLPVAAAAEV LRVATFNTEL SRKGPGLMLR DIAGGRDTQV AAVVSVIASA        60
     RPDILALQGL DWDHEGRALD ALAAQLAAAG WEMAHIFAAQ PNSGRATDLD LDGDRRIGGP       120
     GDAQGYGRFT GQGGIAILSR HPIAQAEIQD FSALRWRDLP GATLPESGGH AFPSEAAQAA       180
     QRLSSTGHWL VPIDTDMGRM VLLTYQAGPP VFDGPEDRNG LRNRDETRFW QLLLDGVVGA       240
     MPDLPFVLAG GANLDPQDGE GYRGTIRALL ADPRLQDPAP ESSGAARAGP QGHAGPDARD       300
     TVDWPGIGRF RVDYVLPSTH WRVVGSGVVW PAPDDPSAGP VSEASRHRLV WVDLSRQ          357
//

If you have problems or comments...

PBIL Back to PBIL home page