(data stored in ACNUC7421 zone)

EMBL: CP000031.PE209

CP000031.PE209       Location/Qualifiers
FT   CDS             complement(234617..235450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0214"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0214"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93539"
FT                   /db_xref="GOA:Q5LX08"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX08"
FT                   /protein_id="AAV93539.1"
FT                   /translation="MIARISGAALRGFLVALVVVIPALYLPSAATTATEIVVLLAILAF
FT                   VLTFAEYNSTFPSFIEFRDAPPLNRMRFIALLTMITFLTLICKERVEPTNITALFSGFG
FT                   LLIAHIADFPYSPVRLVVLMLPVGAAPELIYDVRVTAAVAYVIALLTVVAFWFAVRVRG
FT                   WPTANGAFNVWINLPLFDPTTGGDVVARLQRDGRINMVLGVLLPFLIPAMIKMASDLFD
FT                   PINLYSAQTLIWTMSAWAFLPASMIMRGLAMMRIAELIEEKRRRVYSNAEAMQTA"
     MIARISGAAL RGFLVALVVV IPALYLPSAA TTATEIVVLL AILAFVLTFA EYNSTFPSFI        60
     EFRDAPPLNR MRFIALLTMI TFLTLICKER VEPTNITALF SGFGLLIAHI ADFPYSPVRL       120
     VVLMLPVGAA PELIYDVRVT AAVAYVIALL TVVAFWFAVR VRGWPTANGA FNVWINLPLF       180
     DPTTGGDVVA RLQRDGRINM VLGVLLPFLI PAMIKMASDL FDPINLYSAQ TLIWTMSAWA       240
     FLPASMIMRG LAMMRIAELI EEKRRRVYSN AEAMQTA                                277
//

If you have problems or comments...

PBIL Back to PBIL home page