(data stored in ACNUC7421 zone)

EMBL: CP000031.PE21

CP000031.PE21        Location/Qualifiers
FT   CDS             complement(20571..20924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0021"
FT                   /product="Hpt domain protein"
FT                   /note="identified by match to protein family HMM PF01627"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93352"
FT                   /db_xref="GOA:Q5LWI0"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWI0"
FT                   /protein_id="AAV93352.1"
FT                   /translation="MGQRERRCAMIHWPRVTQLREEVGAEDFEEVVDLFLEEVEEVITR
FT                   LRQAPDRSLLEKDLHFLKGSALSLGFQSFSALCQDGERQSAAGHADTVDLDAIINSFEA
FT                   SKSVFQSELPGHI"
     MGQRERRCAM IHWPRVTQLR EEVGAEDFEE VVDLFLEEVE EVITRLRQAP DRSLLEKDLH        60
     FLKGSALSLG FQSFSALCQD GERQSAAGHA DTVDLDAIIN SFEASKSVFQ SELPGHI          117
//

If you have problems or comments...

PBIL Back to PBIL home page