(data stored in ACNUC9435 zone)

EMBL: CP000031.PE212

CP000031.PE212       Location/Qualifiers
FT   CDS             complement(237948..238112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0217"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93542"
FT                   /db_xref="GOA:Q5LX05"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX05"
FT                   /protein_id="AAV93542.1"
FT                   /translation="MAGLSRQTQDLARLRADMYLDSMTPHDAPSMDLQDRARLRERFFG
FT                   ATRSVLARL"
     MAGLSRQTQD LARLRADMYL DSMTPHDAPS MDLQDRARLR ERFFGATRSV LARL              54
//

If you have problems or comments...

PBIL Back to PBIL home page