(data stored in ACNUC7421 zone)

EMBL: CP000031.PE213

CP000031.PE213       Location/Qualifiers
FT   CDS             238133..239485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0218"
FT                   /product="mechanosensitive ion channel family protein"
FT                   /note="identified by match to protein family HMM PF00924"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93543"
FT                   /db_xref="GOA:Q5LX04"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX04"
FT                   /protein_id="AAV93543.1"
FT                   /translation="MSEDILPATLDELIATLLTEGHRLVGLFLTPGWRQYQLLIIVLLI
FT                   GAALLLSLLTRTHWEAWARSRAGWPKWRLRTLVLLMRRLSLLYFVVLSWMTYLVMQQMT
FT                   WPSRSYVIGVVATLATALLVIALVARAVRNRTIRLVFRWSMWVYATLVALNLTDDVARF
FT                   LDGISIEIGALHISVLGVMKAVLLVGALLVLVRLASQGASNALARNDDISPSMQVLLAK
FT                   AVQVLLYGWVFIVAIRTLGFDLTGLAFLSGAIGVGIGFGLQKVVSNLISGIIILMDRSI
FT                   KPGDVISLGETFGWINALGARYVSVVTRDGREYLIPNEDLITSQVVNWSHSDQYVRLDL
FT                   NFGTSYGDDPHKVRAVSIAAARSVGRVLSGSGRDPVCHIVGFGDSSVDYVLRFWITDPT
FT                   AGLTNIRGNVFLALWDAFQAEGISIPFPQREVRMLENEGGLPQFAGQGGAD"
     MSEDILPATL DELIATLLTE GHRLVGLFLT PGWRQYQLLI IVLLIGAALL LSLLTRTHWE        60
     AWARSRAGWP KWRLRTLVLL MRRLSLLYFV VLSWMTYLVM QQMTWPSRSY VIGVVATLAT       120
     ALLVIALVAR AVRNRTIRLV FRWSMWVYAT LVALNLTDDV ARFLDGISIE IGALHISVLG       180
     VMKAVLLVGA LLVLVRLASQ GASNALARND DISPSMQVLL AKAVQVLLYG WVFIVAIRTL       240
     GFDLTGLAFL SGAIGVGIGF GLQKVVSNLI SGIIILMDRS IKPGDVISLG ETFGWINALG       300
     ARYVSVVTRD GREYLIPNED LITSQVVNWS HSDQYVRLDL NFGTSYGDDP HKVRAVSIAA       360
     ARSVGRVLSG SGRDPVCHIV GFGDSSVDYV LRFWITDPTA GLTNIRGNVF LALWDAFQAE       420
     GISIPFPQRE VRMLENEGGL PQFAGQGGAD                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page