(data stored in ACNUC7421 zone)

EMBL: CP000031.PE215

CP000031.PE215       Location/Qualifiers
FT   CDS             240058..240528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0220"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to SP:Q92LB0; match to
FT                   protein family HMM PF02590"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0220"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93545"
FT                   /db_xref="GOA:Q5LX20"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LX20"
FT                   /protein_id="AAV93545.1"
FT                   /translation="MRVSILAVGRLRTGPEKSLIDDYLTRFDRTGRALGLGPARVVEVE
FT                   DKKNAGMGAEAALLRKALPAGAVLCTLDERGKQLSSPDFADRMAGWRDTGRQDLALVIG
FT                   GADGIDPSLRAEADFSISFGAMVWPHMLVRVMLAEQLYRAATILAGSPYHRV"
     MRVSILAVGR LRTGPEKSLI DDYLTRFDRT GRALGLGPAR VVEVEDKKNA GMGAEAALLR        60
     KALPAGAVLC TLDERGKQLS SPDFADRMAG WRDTGRQDLA LVIGGADGID PSLRAEADFS       120
     ISFGAMVWPH MLVRVMLAEQ LYRAATILAG SPYHRV                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page