(data stored in ACNUC7421 zone)

EMBL: CP000031.PE216

CP000031.PE216       Location/Qualifiers
FT   CDS             240537..241022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0221"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:CAE38612.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0221"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93546"
FT                   /db_xref="GOA:Q5LX19"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX19"
FT                   /protein_id="AAV93546.1"
FT                   /translation="MAELLIVYHSRTGGSRQMAEACAAGAQSEIATTLLTAEAAGPEDL
FT                   LRASGYVFCCPENLAAISGAMKEFLDRCYYPVLGRIEGRAYAQMICAGSDGQNAARQLA
FT                   RIATGWRLKEVQPPLILCTHAQTPEAIQAPKHIPEAELGQCRDLGQALGAGLAMGMF"
     MAELLIVYHS RTGGSRQMAE ACAAGAQSEI ATTLLTAEAA GPEDLLRASG YVFCCPENLA        60
     AISGAMKEFL DRCYYPVLGR IEGRAYAQMI CAGSDGQNAA RQLARIATGW RLKEVQPPLI       120
     LCTHAQTPEA IQAPKHIPEA ELGQCRDLGQ ALGAGLAMGM F                           161
//

If you have problems or comments...

PBIL Back to PBIL home page