(data stored in ACNUC7421 zone)

EMBL: CP000031.PE219

CP000031.PE219       Location/Qualifiers
FT   CDS             242986..243903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0224"
FT                   /product="polyphosphate kinase, putative"
FT                   /note="identified by similarity to GB:AAN87337.1; match to
FT                   protein family HMM PF03976"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93549"
FT                   /db_xref="GOA:Q5LX16"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LX16"
FT                   /protein_id="AAV93549.1"
FT                   /translation="MTHESDDPSLDWLEAELEDSLDEDFEIEFSEPMLSMEIRRIYKDQ
FT                   RPDLLDRQVYFRNLLRLQAELIKLQDWVQHTNSKVLIIMEGRDAAGKGGVIKRITQRLN
FT                   PRIARVVALPAPSRREQSQWYFQRYVPYLPSGGEMVLFDRSWYNRAGVERVMGFATEDQ
FT                   VEQFFQDVPEFERMLVRSGIILLKYWFSITDEEQQLRFLMRVHDPMKQWKLSPMDLESR
FT                   IRWEQYTKAKEQMFSRTNIPEAPWYIVEGNDKKRERLNCIEHLLSKIPYEDIPHEKVTL
FT                   PDRRYNPDYERQVLPDELYVPKVY"
     MTHESDDPSL DWLEAELEDS LDEDFEIEFS EPMLSMEIRR IYKDQRPDLL DRQVYFRNLL        60
     RLQAELIKLQ DWVQHTNSKV LIIMEGRDAA GKGGVIKRIT QRLNPRIARV VALPAPSRRE       120
     QSQWYFQRYV PYLPSGGEMV LFDRSWYNRA GVERVMGFAT EDQVEQFFQD VPEFERMLVR       180
     SGIILLKYWF SITDEEQQLR FLMRVHDPMK QWKLSPMDLE SRIRWEQYTK AKEQMFSRTN       240
     IPEAPWYIVE GNDKKRERLN CIEHLLSKIP YEDIPHEKVT LPDRRYNPDY ERQVLPDELY       300
     VPKVY                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page