(data stored in ACNUC9435 zone)

EMBL: CP000031.PE222

CP000031.PE222       Location/Qualifiers
FT   CDS             complement(245787..247157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0227"
FT                   /product="PaxA, putative"
FT                   /note="identified by similarity to GB:AAF15370.1; match to
FT                   protein family HMM PF00353"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0227"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93552"
FT                   /db_xref="GOA:Q5LX13"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX13"
FT                   /protein_id="AAV93552.1"
FT                   /translation="MSQASTLEREMLELINNERTSRGLNPVTLELKLNDASEDHSKWML
FT                   ERDVFSHTGVNGSSPGDRIEKTGFKFEGNSIWAENIAWQSERGAPGLSDDVKNLHESLM
FT                   NSPGHRANILNPDVTLVGIGIERGNFEGYDAVMVTQNFARTAAEVELDTGAPTPEPEPK
FT                   PEPEPKPEPEPKPEPEPKPEPEPKPEPEPKPEPEPKPEPEPKPEPEPKPEPEPKPEPEP
FT                   KPEPEPKPEPEPKPEPEPKPEPEPKPEPEPKPEPEPKPEPEPKPEPEPENACEGSDGSD
FT                   LIFTDDTGGAAHGKGGNDIMIGGRGMDIFWGDGGQDILIGGRGMDKLSGGDGDDVLLGG
FT                   RGKDMLDGGAGNDLLIGGRGKDALDGGEGDDHMLGGAGADTFHFSTGKDVVFDFGVRGQ
FT                   ADLVDLGKADGIADFDDLKANHLSEVDGDAVITDAAGNSLTLLGVQMDMLDAQDFLF"
     MSQASTLERE MLELINNERT SRGLNPVTLE LKLNDASEDH SKWMLERDVF SHTGVNGSSP        60
     GDRIEKTGFK FEGNSIWAEN IAWQSERGAP GLSDDVKNLH ESLMNSPGHR ANILNPDVTL       120
     VGIGIERGNF EGYDAVMVTQ NFARTAAEVE LDTGAPTPEP EPKPEPEPKP EPEPKPEPEP       180
     KPEPEPKPEP EPKPEPEPKP EPEPKPEPEP KPEPEPKPEP EPKPEPEPKP EPEPKPEPEP       240
     KPEPEPKPEP EPKPEPEPKP EPEPKPEPEP ENACEGSDGS DLIFTDDTGG AAHGKGGNDI       300
     MIGGRGMDIF WGDGGQDILI GGRGMDKLSG GDGDDVLLGG RGKDMLDGGA GNDLLIGGRG       360
     KDALDGGEGD DHMLGGAGAD TFHFSTGKDV VFDFGVRGQA DLVDLGKADG IADFDDLKAN       420
     HLSEVDGDAV ITDAAGNSLT LLGVQMDMLD AQDFLF                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page