(data stored in ACNUC9435 zone)

EMBL: CP000031.PE223

CP000031.PE223       Location/Qualifiers
FT   CDS             247265..248473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0228"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93553"
FT                   /db_xref="GOA:Q5LX12"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX12"
FT                   /protein_id="AAV93553.1"
FT                   /translation="MRPGHWAGRRTANPPFQPPAERRARPTRLLAENRSLVTAPGRFAT
FT                   PLSPPDKTGDSIRGEMERRQGKDTMTAADPNLSAGADQPEGATTLTGILFLLLATTIFP
FT                   IQDVIIKSLSSEFAVHQIVFWRSVFALPIAAAMALYEGSLWPWKIGSWPLQLTRAVAAF
FT                   SSYLVYYMALAAIGLAETAAITFSTPIFVTLLAAVFLGEKIGLWRWLAVFLGMAGVLVI
FT                   VQPGASVFEPAALLALAAALFYAISIIATRRLGNRTNGGTMTLVTLLVYIVGGTVLGLV
FT                   FSGLETASPHPSLAFLYRDWIAPAPMDWLALAALGVTSGIGFFALSQAYRMAEASVVTP
FT                   FEYTYLPWAVLWGYLVFGVLPVMSTWIGLTLIVGSGLLILFRETMRGRRIVRRRGLGVM
FT                   RQR"
     MRPGHWAGRR TANPPFQPPA ERRARPTRLL AENRSLVTAP GRFATPLSPP DKTGDSIRGE        60
     MERRQGKDTM TAADPNLSAG ADQPEGATTL TGILFLLLAT TIFPIQDVII KSLSSEFAVH       120
     QIVFWRSVFA LPIAAAMALY EGSLWPWKIG SWPLQLTRAV AAFSSYLVYY MALAAIGLAE       180
     TAAITFSTPI FVTLLAAVFL GEKIGLWRWL AVFLGMAGVL VIVQPGASVF EPAALLALAA       240
     ALFYAISIIA TRRLGNRTNG GTMTLVTLLV YIVGGTVLGL VFSGLETASP HPSLAFLYRD       300
     WIAPAPMDWL ALAALGVTSG IGFFALSQAY RMAEASVVTP FEYTYLPWAV LWGYLVFGVL       360
     PVMSTWIGLT LIVGSGLLIL FRETMRGRRI VRRRGLGVMR QR                          402
//

If you have problems or comments...

PBIL Back to PBIL home page