(data stored in ACNUC7421 zone)

EMBL: CP000031.PE225

CP000031.PE225       Location/Qualifiers
FT   CDS             248890..249570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0230"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAK25258.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93555"
FT                   /db_xref="GOA:Q5LX28"
FT                   /db_xref="InterPro:IPR012762"
FT                   /db_xref="InterPro:IPR013718"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX28"
FT                   /protein_id="AAV93555.1"
FT                   /translation="MSPTYEEARNHLLDAALTHVAFDGWTEETFRAAAAETGLDMDFAR
FT                   AICPRGAVDLALTYHARGDAAMVERLAAAELSELRFRDRIAAAVRFRLEAVEDKEAVRR
FT                   GVTLFALPAHAGEGAKAIWQTCDVIWSALGDSSEDVNWYTKRATLSAVYSATVLYWLGD
FT                   ETPGHEATWEFLDRRIDNVMQFEKFKADVQKNPLLKPLLAGPNWLFAQMRAPRDKGDLP
FT                   GSLG"
     MSPTYEEARN HLLDAALTHV AFDGWTEETF RAAAAETGLD MDFARAICPR GAVDLALTYH        60
     ARGDAAMVER LAAAELSELR FRDRIAAAVR FRLEAVEDKE AVRRGVTLFA LPAHAGEGAK       120
     AIWQTCDVIW SALGDSSEDV NWYTKRATLS AVYSATVLYW LGDETPGHEA TWEFLDRRID       180
     NVMQFEKFKA DVQKNPLLKP LLAGPNWLFA QMRAPRDKGD LPGSLG                      226
//

If you have problems or comments...

PBIL Back to PBIL home page