(data stored in ACNUC7421 zone)

EMBL: CP000031.PE226

CP000031.PE226       Location/Qualifiers
FT   CDS             249647..250630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0231"
FT                   /product="alcohol dehydrogenase, zinc-containing"
FT                   /note="identified by match to protein family HMM PF00107"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93556"
FT                   /db_xref="GOA:Q5LX27"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX27"
FT                   /protein_id="AAV93556.1"
FT                   /translation="MSQQMRAVEISRPGGPEVLQLTQRPRPEPGHGQVLIKVAYAGVNR
FT                   PDALQRAGAYDPPPGASDLPGLECSGEVVAVGPGAEDVAVGDKVCALLPGGGYADYVVT
FT                   PAAHCLPVPQGMALREAACLPETFFTVWSNVFTRGGLKAGERFLVHGGSSGIGTTAIQL
FT                   AHAFGARVFATAGSDDKCRACLDLGAERAINYRDEDFVKVMRSEGGADLILDMVGGDYI
FT                   PRNVKALAEDGRLVQIAFLQGPVVELNFALMMVKRLTLTGSTLRPQSDLAKADIARDLR
FT                   EAVWPLLDAGRIAPVMDSEFDLGDAAAAHARMESSGHIGKIVLKVG"
     MSQQMRAVEI SRPGGPEVLQ LTQRPRPEPG HGQVLIKVAY AGVNRPDALQ RAGAYDPPPG        60
     ASDLPGLECS GEVVAVGPGA EDVAVGDKVC ALLPGGGYAD YVVTPAAHCL PVPQGMALRE       120
     AACLPETFFT VWSNVFTRGG LKAGERFLVH GGSSGIGTTA IQLAHAFGAR VFATAGSDDK       180
     CRACLDLGAE RAINYRDEDF VKVMRSEGGA DLILDMVGGD YIPRNVKALA EDGRLVQIAF       240
     LQGPVVELNF ALMMVKRLTL TGSTLRPQSD LAKADIARDL REAVWPLLDA GRIAPVMDSE       300
     FDLGDAAAAH ARMESSGHIG KIVLKVG                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page