(data stored in ACNUC9435 zone)

EMBL: CP000031.PE228

CP000031.PE228       Location/Qualifiers
FT   CDS             251746..252174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0233"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="identified by match to protein family HMM PF01037;
FT                   match to protein family HMM TIGR01199"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93558"
FT                   /db_xref="GOA:Q5LX25"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX25"
FT                   /protein_id="AAV93558.1"
FT                   /translation="MDQLDRQIVAALQHNARESTTKIAARLGVARTTVHERITRMESRG
FT                   VIAGYSVVLREPQDESKVQVVVLLEVQQKETTRIVKRLEAYPEIKLCLSINGEYDLLLS
FT                   AEAPRIEDLDILVDEVGAIPGILRTNTFVVFGRRIDRT"
     MDQLDRQIVA ALQHNAREST TKIAARLGVA RTTVHERITR MESRGVIAGY SVVLREPQDE        60
     SKVQVVVLLE VQQKETTRIV KRLEAYPEIK LCLSINGEYD LLLSAEAPRI EDLDILVDEV       120
     GAIPGILRTN TFVVFGRRID RT                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page