(data stored in ACNUC7421 zone)

EMBL: CP000031.PE231

CP000031.PE231       Location/Qualifiers
FT   CDS             complement(255034..255972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0236"
FT                   /product="glycerophosphoryl diester phosphodiesterase,
FT                   putative"
FT                   /note="identified by similarity to SP:P37965; match to
FT                   protein family HMM PF03009"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0236"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93561"
FT                   /db_xref="GOA:Q5LX22"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="PDB:3L12"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX22"
FT                   /protein_id="AAV93561.1"
FT                   /translation="MNGFSQLEGLRGHPSVVRVIGHRGARGVMPENTLEGFAFTLAAGV
FT                   RALEFDVVMTADGVPVVTHNHHLANAMTRDGQGHWLTGAERQVAEMTYAEIRALDVGGL
FT                   DGRTVYGRRFPDQAFLTGIHVPRLGELLDLCAGYGDQAPYLLLELKSDPALMHDHAARA
FT                   EMVAAVLADVRRYRMEPRTVMHSFDWALLGECRRQAPDLPTSYLSQLPENADDPGEDSA
FT                   KPVGPDYDRMTESLPQAVASAGGQLWCPYFLDVTPELVAEAHDLGLIVLTWTVNEPEDI
FT                   RRMATTGVDGIVTDYPGRTQRILIDMGLSWT"
     MNGFSQLEGL RGHPSVVRVI GHRGARGVMP ENTLEGFAFT LAAGVRALEF DVVMTADGVP        60
     VVTHNHHLAN AMTRDGQGHW LTGAERQVAE MTYAEIRALD VGGLDGRTVY GRRFPDQAFL       120
     TGIHVPRLGE LLDLCAGYGD QAPYLLLELK SDPALMHDHA ARAEMVAAVL ADVRRYRMEP       180
     RTVMHSFDWA LLGECRRQAP DLPTSYLSQL PENADDPGED SAKPVGPDYD RMTESLPQAV       240
     ASAGGQLWCP YFLDVTPELV AEAHDLGLIV LTWTVNEPED IRRMATTGVD GIVTDYPGRT       300
     QRILIDMGLS WT                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page