(data stored in ACNUC9435 zone)

EMBL: CP000031.PE245

CP000031.PE245       Location/Qualifiers
FT   CDS             274505..274942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0255"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93575"
FT                   /db_xref="GOA:Q5LX34"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX34"
FT                   /protein_id="AAV93575.1"
FT                   /translation="MLDRALTLDELLCFSLYSANHAMGRLYRPLLARFDLTYPQYLVLV
FT                   ALWQRDGRKVSALGAELQLESNTLTPLLKRMEAAGLIRRARNPEDERSVIVTLTDKGRG
FT                   LEGEAAEISNCILAAADADIAELAELRDRLHRLTARLREAG"
     MLDRALTLDE LLCFSLYSAN HAMGRLYRPL LARFDLTYPQ YLVLVALWQR DGRKVSALGA        60
     ELQLESNTLT PLLKRMEAAG LIRRARNPED ERSVIVTLTD KGRGLEGEAA EISNCILAAA       120
     DADIAELAEL RDRLHRLTAR LREAG                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page