(data stored in ACNUC7421 zone)

EMBL: CP000031.PE246

CP000031.PE246       Location/Qualifiers
FT   CDS             complement(274955..275284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0256"
FT                   /product="copper-binding protein, plastocyanin/azurin
FT                   family"
FT                   /note="identified by match to protein family HMM PF00127"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93576"
FT                   /db_xref="GOA:Q5LX52"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="InterPro:IPR035668"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX52"
FT                   /protein_id="AAV93576.1"
FT                   /translation="MRLTRRQVCFGAGGAIVGSALPASGSTPVVVDIRSFVFEPAEITI
FT                   RAGETIVWINHDFAPHTATDDEVNWDTGELEKDAQAAIRFDTPGTYPYFCAYHPHMTGT
FT                   VIVTA"
     MRLTRRQVCF GAGGAIVGSA LPASGSTPVV VDIRSFVFEP AEITIRAGET IVWINHDFAP        60
     HTATDDEVNW DTGELEKDAQ AAIRFDTPGT YPYFCAYHPH MTGTVIVTA                   109
//

If you have problems or comments...

PBIL Back to PBIL home page