(data stored in ACNUC7421 zone)

EMBL: CP000031.PE25

CP000031.PE25        Location/Qualifiers
FT   CDS             23831..24427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0025"
FT                   /product="hydrolase, NUDIX family"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93356"
FT                   /db_xref="GOA:Q5LWH6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWH6"
FT                   /protein_id="AAV93356.2"
FT                   /translation="MTDPIDSLMAALARTGPGSSDFDLNPGTILPEGRRLRPAGVLVPV
FT                   TLAHGAPRVILTKRSSALKHHPGQIAFPGGKQDEGDADVIAAALREAEEEIGLTRTLPQ
FT                   VLGTLPAHETVTAFTVTPVVAVVERTFDVRPEPGEVEEVFSVPLAHLMRPENYSVQSRR
FT                   WRGQRRHYFTVPFGPYYIWGATARMLRGLAERMQQ"
     MTDPIDSLMA ALARTGPGSS DFDLNPGTIL PEGRRLRPAG VLVPVTLAHG APRVILTKRS        60
     SALKHHPGQI AFPGGKQDEG DADVIAAALR EAEEEIGLTR TLPQVLGTLP AHETVTAFTV       120
     TPVVAVVERT FDVRPEPGEV EEVFSVPLAH LMRPENYSVQ SRRWRGQRRH YFTVPFGPYY       180
     IWGATARMLR GLAERMQQ                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page