(data stored in ACNUC7421 zone)

EMBL: CP000031.PE251

CP000031.PE251       Location/Qualifiers
FT   CDS             complement(279220..280086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0261"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93581"
FT                   /db_xref="GOA:Q5LX47"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX47"
FT                   /protein_id="AAV93581.1"
FT                   /translation="MSRQAENLSGSLYMVAAMGAFALEDMFVKSATAVLPVGQVLILFG
FT                   LGGMGIFALLARWRGEAAFVRPDRTLAIRSSFEVMGRICYTLALALTPLTSTSAILQAT
FT                   PLVVAMGAALFLGETVGWRRWVAILIGLAGVLLILRPGMQGFVPASIFAVLGMIGFAGR
FT                   DLATRAARPRLSNAQLGVYGFGALVVSGVLALVWTGGATLPDAHTALQLGAAILFGVLA
FT                   YECLTRAMRRGEISVIAPFRYSRLVFAMILGIVVFGETPDAATWIGSAIIVAGGIYNIL
FT                   REGRSRR"
     MSRQAENLSG SLYMVAAMGA FALEDMFVKS ATAVLPVGQV LILFGLGGMG IFALLARWRG        60
     EAAFVRPDRT LAIRSSFEVM GRICYTLALA LTPLTSTSAI LQATPLVVAM GAALFLGETV       120
     GWRRWVAILI GLAGVLLILR PGMQGFVPAS IFAVLGMIGF AGRDLATRAA RPRLSNAQLG       180
     VYGFGALVVS GVLALVWTGG ATLPDAHTAL QLGAAILFGV LAYECLTRAM RRGEISVIAP       240
     FRYSRLVFAM ILGIVVFGET PDAATWIGSA IIVAGGIYNI LREGRSRR                    288
//

If you have problems or comments...

PBIL Back to PBIL home page