(data stored in ACNUC7421 zone)

EMBL: CP000031.PE253

CP000031.PE253       Location/Qualifiers
FT   CDS             complement(280748..281791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0263"
FT                   /product="membrane protein"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93583"
FT                   /db_xref="GOA:Q5LX45"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX45"
FT                   /protein_id="AAV93583.1"
FT                   /translation="MTADSQTCFCVCTMAVTVTNNQAIDLSRAKAQGRAMAKPLTSHRP
FT                   ILAVSLKLGALVLFTSMSALIKVLSADFPAGEMVFFRSLFAIPVIILWLLARGELRQGL
FT                   IVKKPMGHFWRGVLGTGAMGLTFTGLGLLPLPEVTAIGYATPIFTLILAALMLGETIRL
FT                   VRIGAVALGLLGVLIMLWPRLGTGASLDQAATIGALCVLAATVARAFVQIHIRQLVQVD
FT                   HAAAIVFYFSLTATLLSGLTAFFGWVTPTPEQAAILILTGLVGGVAQILVTSSYRFGQA
FT                   SMLAPYDYASMLFAIIIGYIWFDEWPTLVMLAGAMLVIAGNVVVIWRERQLGLERGKAR
FT                   SVTDPKG"
     MTADSQTCFC VCTMAVTVTN NQAIDLSRAK AQGRAMAKPL TSHRPILAVS LKLGALVLFT        60
     SMSALIKVLS ADFPAGEMVF FRSLFAIPVI ILWLLARGEL RQGLIVKKPM GHFWRGVLGT       120
     GAMGLTFTGL GLLPLPEVTA IGYATPIFTL ILAALMLGET IRLVRIGAVA LGLLGVLIML       180
     WPRLGTGASL DQAATIGALC VLAATVARAF VQIHIRQLVQ VDHAAAIVFY FSLTATLLSG       240
     LTAFFGWVTP TPEQAAILIL TGLVGGVAQI LVTSSYRFGQ ASMLAPYDYA SMLFAIIIGY       300
     IWFDEWPTLV MLAGAMLVIA GNVVVIWRER QLGLERGKAR SVTDPKG                     347
//

If you have problems or comments...

PBIL Back to PBIL home page